SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008902 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008902
Domain Number 1 Region: 209-391
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-41
Family Pentraxin (pentaxin) 0.00074
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008902
Domain Number - Region: 82-179
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0392
Family Apolipoprotein A-I 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008902   Gene: ENSTGUG00000008623   Transcript: ENSTGUT00000008998
Sequence length 403
Comment pep:known_by_projection chromosome:taeGut3.2.4:14:14822795:14831244:-1 gene:ENSTGUG00000008623 transcript:ENSTGUT00000008998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCTSLPLDAAGAGCPLPPVPMQGGALPPEEELKATVLQLRETVLQQKETIGSQREAIREL
TGKLSRCEGADGKSAAGAWKNEDTMGDLPRDPAQVIDQLSRTMQTLKDRLESLEHQLRAN
VSYAALPGDLREMLQRRLGDLERQLLSKVAELEDEKSLLHNETSAHRQKTETALNALLER
VSELEKGNSAFKSPDEFKVSLPLRTNYLYGKIKKTLPELYAFTVCLWLRSSASPGIGTPF
SYAVPGQANEIVLIEWGNNPIELLINDKVAQLPLFISDGKWHHICITWTTRDGMWEAFQD
GGKLGTGENLAPWHPIKPGGVLILGQEQDTVGGRFDATQAFVGEMSQFNIWDRVLRAEDI
MNIANCSINMPGNIIPWVDNNVDVFGGATKWPVETCEERLLDL
Download sequence
Identical sequences H0ZE90
ENSTGUP00000008902 59729.ENSTGUP00000008902 ENSTGUP00000008902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]