SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008907 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008907
Domain Number 1 Region: 359-554,655-910
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-112
Family Ras GEF 0.00021
Further Details:      
 
Domain Number 2 Region: 102-240
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.57e-43
Family DEP domain 0.000000199
Further Details:      
 
Domain Number 3 Region: 562-664
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.82e-35
Family Ras-binding domain, RBD 0.0012
Further Details:      
 
Domain Number 4 Region: 233-362
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.15e-25
Family cAMP-binding domain 0.00000101
Further Details:      
 
Domain Number 5 Region: 3-56
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000288
Family cAMP-binding domain 0.0000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008907   Gene: ENSTGUG00000008556   Transcript: ENSTGUT00000009004
Sequence length 912
Comment pep:known chromosome:taeGut3.2.4:7:15583055:15728829:1 gene:ENSTGUG00000008556 transcript:ENSTGUT00000009004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDAVTICTLGIGTAFGESILDNTPRHATIVTREHSELLRIEQKDFKALWEKYRQYMSGLL
TPPYGVMETGSNNDIERQEEWTPLIDPHIPHHPTKTITQVPSEKILRAGKILRNTILSRA
PHMIRDRKYHLKTYRQCCVGTELVDWMMQQSPCVHLRTQAVGMWQVLLEEGVLNHVDQEH
HFQDKYLFYRFLDDEREDAPLPTEEEKKECDEELQDTMLLLSQIGPDAHMRMILRKPPGQ
RTVDDLEFIYEELLHIKALSHLSTTVKRELAGVLIFESHPKAGTVLFNQGEEGTSWYIIL
KGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILR
DVEANTVRLKEHDQDVLVLEKIPAGNRISNQGNSQPQHKYIVMSGTPEKILEHFLETMRL
EATLNEATDSVSNDFIMMHCVFMPNSQLCPALMAQYPFPSQGTEQEKMDYALNNKRRVIR
LVLQWAALYGDLLQEDEAAMAFLEEFYVSVSDDTRMIAALKEQLPELEKIVKQISEEPKA
PQKKHKVLLQLFNTSDDRAQKRQPIRGSDEVLFKVYCIDQTCTTIRVPVSSSVKEVISAV
ADKLGSGEGLIIVKMSSGGEKVVLKPHDVSVFTTLSVNGRLFACPRDQFDSLAPLPEQEG
PSTGTVGTFELMSSKDLAHQMTIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRR
FNEIQFWVVTEICLCSQLSKRVQLLKKYIKIAAHCKEYKNLNSFFAIIMGLSNVAVSRLS
LTWEKLPSKFKKIYAEFESLMDPSRNHRAYRLTVAKLDPPIIPFMPLLIKDMTFTHEGNK
TFTDNLVNFEKMRMIANTVRTVKFCRSQSFNPDAALTNKNHQDVRSYVRQLNVIDNQRTL
SQMSHRLEPRRA
Download sequence
Identical sequences H0ZE95
59729.ENSTGUP00000008907 ENSTGUP00000008907 ENSTGUP00000008907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]