SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008919 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008919
Domain Number 1 Region: 1383-1553,1602-1672,1738-1837
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 8.52e-118
Family Mammalian PLC 0.00000497
Further Details:      
 
Domain Number 2 Region: 510-718,746-770
Classification Level Classification E-value
Superfamily Ras GEF 4.84e-38
Family Ras GEF 0.0045
Further Details:      
 
Domain Number 3 Region: 2124-2234
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.99e-37
Family Ras-binding domain, RBD 0.00000276
Further Details:      
 
Domain Number 4 Region: 1998-2104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.5e-29
Family Ras-binding domain, RBD 0.0000194
Further Details:      
 
Domain Number 5 Region: 1863-1974
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.48e-23
Family PLC-like (P variant) 0.0028
Further Details:      
 
Domain Number 6 Region: 1199-1231,1309-1372
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000661
Family EF-hand modules in multidomain proteins 0.036
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008919
Domain Number - Region: 849-890,921-998
Classification Level Classification E-value
Superfamily PH domain-like 0.000246
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008919   Gene: ENSTGUG00000008633   Transcript: ENSTGUT00000009016
Sequence length 2293
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:19107863:19232979:-1 gene:ENSTGUG00000008633 transcript:ENSTGUT00000009016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEEMTASVLFSVVQGKVIAAQSAGDENTENALDTSVIRRHTASSGRQTTHNLSYLHRL
EEKSLQGSVPKIFPLAKEQLANDKSNENFWERNSSISDSVEFLNINCNIVQKNYKSNISC
SQLYQSCAPLAGEEACLETGIPVSLERAMLAEIQLKMNGPSLRSQTAVNKNDSSDPDKVA
FFHLHCASERNISKALCGLHNSFILDDCLQPVSDGDGNTTGSPACTCSIMQLTNNCENKN
GQQLYEDALRDKYLCLERAPRKVKVACSGHSFCGSNFTGRMPSKPFLSHFEDCNDNCEEE
LEEDFFRNKKERSTLLIRRFCKNDKEVKKSVYTGTRAIFRTLPLGHIGTVAWNYVERRRN
NSMKHCPSMYELDSGVTGGSEGAPHQSQPVTPIFSTVTEEEEGAEDIFEYIPHLLRKLPT
SVTDCIYKGDGFCVKPCVTGAYCQYRATLQRTALSNYITGALLEATTSLGARSGLLNIFG
GSTGRTMLKERQACTSMAGSSILPSSVAGISKELLELQHLIQFPEEVASILTEQEQELYR
KVLPIDYLCFLTRDLGSAECQSKLPSLKASISATILSSPNGEHNAVEDLVTRFNEVSSWV
TWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSDI
ETMRSLKDAMAQHESSSEYRKVVNRALNIPGCKVVPFCGVFLKELCEVLDGASSLIRLCP
RYNSQDETLEFVSDYSGQDNFLQRVGQDGLNNPEKDPTTNKFFQTIRSCTRSLESEEGED
NVSEGSNSRKNSLKDKNCYQFLIGDLSDSESDIFEQLKEWDTSSTEEQQKAFCHGIELIP
WYVLSIRADVHQFLQQGATVIHYDQDTHLSARCFLQLQPDNSTLTWTKPTTVCPANAKAK
LGVLGNTAELGKYQFLGNTGLVEGFLDLFSAKAVYMGHSGIDMHTVCVQNKLCNMSLEEN
GITLLYGLQTTDNKLLHFVAPKYTARMLYDGLLELTKAVRKMRRFPDQRLQWLRKQYVSL
YQEDGRFEGPTLAQAVELFGGRRWSARSTGTGSLTKSTEKPNMQRNNTLGISTAKKKKKV
LIRGESGEATDDEMATRKAKSCKEYRNRSGSDPQDIDEQEEPDQNIIINASPSNNLPSRR
AHSLTASGSPNLGATSSSPARPVSSPVISSSKSQSSTWSSSSWHGRVKGGMKGFQNFMVS
DSNMTFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGLDPAPLYTNLKIDENSSGFQP
DLDLLTRNVSDLGLFIKSRQQLSDNQRQISDAIAAASIVTNGTGVESTSLGVFGVGIQQL
NDFLVNCQGEHCTYDEILSIIQKFEPSVNMCQQGLLSFEGFARFLMDKDNFASKNDESQE
NIEDLQFPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPI
IYHGHTLTTKISFKEVVEAIERNAFITSDMPVIISIENHCSLPQQRKMAEIFKNVFGDKL
VTKFLFESDFSDDPMLPSPGQLRRKILLKNKKLKAHQTPVDILKQKAHQLAHLQAQASNG
ASNPTPTNEEEEDEEDEYDYDYESLSDDNILEDRPENKLSSDKLQFEYNEENAKRLKKAD
CATYNNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNPSGSSR
GKERKSRKSIFGNNPGRLSPGESAALAKASGKGPFDAMRQTWEDPCSPYNSPASLSAIIR
TPKCYHISSLNENAAKRLCRRYSQKLIQHTTCQLLRTYPAATRIDSSNPHPLIFWLHGVQ
LVALNYQTDDLPLQLNAAMFEANGGCGYVLKPPVLWDKNCSMYQHFCPLERDLDNKEPAI
YSLTIVSGQNVCPSNSTGSPCIEIDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHF
EDLVFLRFAVVENNCSAVTAQRIIPLKALKRGYRHVQLHNLHNETLEISSLFINSRRMEE
SPSGNSLPASMLFSQGERKAAVTYKVTVHGIPGPEPFTVFSVSAGTTAAQLLHQILATIK
GTESCAADYFLMEEKSFISKEKSECRKPPFQRVIGPEEGLVQLLNSWFPEEGYVGRIIFK
TREENLNERNVFQEAKEEAAISSEDDSFFVQVHDVSPEQPRTVIKAPRLSTAQDVIQQTL
CKAKYSYSILSNPNPSDYVLLEEVTKEPANKKSSTSKPSQRILSDQECVFQAQSKWKGAG
KFILKLKEQVQAARDDKRKGISFTSELKKLTKSSKQYRGFVSPALQGLSDGAQGREERAA
CAVAFSDTMEYKD
Download sequence
Identical sequences H0ZEA7
59729.ENSTGUP00000008919 ENSTGUP00000008919 ENSTGUP00000008919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]