SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008938 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008938
Domain Number 1 Region: 268-388
Classification Level Classification E-value
Superfamily TIMP-like 3.92e-36
Family Netrin-like domain (NTR/C345C module) 0.00022
Further Details:      
 
Domain Number 2 Region: 6-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 127-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008938   Gene: ENSTGUG00000008671   Transcript: ENSTGUT00000009035
Sequence length 388
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:11945426:11985138:-1 gene:ENSTGUG00000008671 transcript:ENSTGUT00000009035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPTFTCGGVVSGESGFIGSEGFPGVYPPNSKCTWKITVPEGKVVVLSFRYLDLESDNLCR
YDFVDIYSGHANGQRIGRFCGTVKPGALVSSSNKMLVQMTSDANTAGSGFIAKFSAAEPH
ERGDQYCGGRLEKPSGSFHTPNWPERDYPAGVSCSWHIVAPKNQLIELKFEKFDVERDNY
CRYDYVAVFNGGEINDAKRIGKYCGDSPPAPILSEKNELLVQFLSDLSLTADGFIGHYKF
RPKKLLRTTALPTTTTVPATSTVKPTVALCQQKCKRSGTLESNYCSSNFVITGTVITAVT
RAGSLHATISIINVYKEGNLAIQQAGKNMSAKILVVCKQCPLIRRGLNYIIMGQVEEDGR
GKVFPNSFVMSFKTKNSKILNALKNKTC
Download sequence
Identical sequences H0ZEC6
ENSTGUP00000008938 ENSTGUP00000008938 59729.ENSTGUP00000008938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]