SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008956 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008956
Domain Number 1 Region: 972-1264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-80
Family Protein kinases, catalytic subunit 0.000000000176
Further Details:      
 
Domain Number 2 Region: 326-492
Classification Level Classification E-value
Superfamily L domain-like 1.39e-51
Family L domain 0.000000113
Further Details:      
 
Domain Number 3 Region: 35-188
Classification Level Classification E-value
Superfamily L domain-like 2.84e-42
Family L domain 0.000000343
Further Details:      
 
Domain Number 4 Region: 487-606
Classification Level Classification E-value
Superfamily Fibronectin type III 5.69e-31
Family Fibronectin type III 0.00000936
Further Details:      
 
Domain Number 5 Region: 786-926
Classification Level Classification E-value
Superfamily Fibronectin type III 9.22e-22
Family Fibronectin type III 0.0000743
Further Details:      
 
Domain Number 6 Region: 609-687,789-827
Classification Level Classification E-value
Superfamily Fibronectin type III 4.56e-21
Family Fibronectin type III 0.00029
Further Details:      
 
Domain Number 7 Region: 169-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000044
Family Growth factor receptor domain 0.000000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008956   Gene: ENSTGUG00000008636   Transcript: ENSTGUT00000009053
Sequence length 1363
Comment pep:known_by_projection chromosome:taeGut3.2.4:10:17184337:17347042:-1 gene:ENSTGUG00000008636 transcript:ENSTGUT00000009053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSGAGGGSLAVVWGFLLVFAALCLWPTNGEICGPNVDIRNDIHELKRLENCTVIEGFLQ
ILLISKAEDYRNFRFPKLTVITDYLLLFRVAGLESLSDLFPNLTVIRGRNLFYNYALVIF
EMTNLKEIGLHNLRNITRGAIRIEKNSDLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTSINNEYNYRCWTTNHCQKMCPSSCGKRACTDQNECCHPECLGSCT
APDNNTACVACRNYYYEGVCLPTCPPNTYKFEGWRCVTREFCSKVPATDASEYEKFVIHN
DECMAECPSGFIRNGSQSMFCSPCEGPCPKICEDGKTKTIDSVTSAQMLQGCTILKGNLL
INIRRGNNIASELENFMGLIETVTGYVKIRHSHALVSLSFLKNLRYILGEEQVDGNYSFY
VLDNHNLQQLWDWNHHNLTISEGKMYFAFNPKLCVSEIYRMEEVSGTKGRQSKGDINPRN
NGERASCESKILHFVSNTTLKNRIKLTWERYRPPDYRDLISFTVYYKEAPFKNVTEYDGQ
DACGSNSWNMVDVDLPPNKENNPGILLQGLKPWTQYAIYVKAVTLTMMENHHIHGAKSEI
IYIRTNAAVPSIPLDVISASNSSSQLIVKWNPPSLPNGNLSYYIVRWQQQPQDSYLYRHN
YCSKDKVPIRRYADGTIDTEEATEPTKPEGCGGEKGPCCACPKTEAEKQAEKEEAEYRKV
FENFLHNSIFVPRPDRKRRDVFRIANATLATRSRNATGTDHFTNASDTEESEVEYPFFET
KVDGKERTVISHLQPFTLYRIDIHSCNHEADTLGCSASNFVFARTMPSEGADNIPGTVSW
EAKEENTVYLKWLEPANPNGLILMYEIKYGQHGEEKRECVSRQEYKKLGGAKLTHLNPGN
YSARVQATSLAGNGSWTEPISFYVQPKSANYGNFLHLVIVLPIVLLFILGALLVMLYVVN
KKRNSDRLGNGVLYASVNPEYFSASDVYVPDEWEVPREKITMCRELGQGSFGMVYEGIAK
GVVKDEPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPDTENNPGQAPPTLKKMIQMAGEIADGMAYLNANKFVHRDLAAR
NCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFG
VVLWEIATLAEQPYQGMTNEQVLRFVMEGGLLEKPDNCPDMLFELMRMCWQYNPKMRPSF
LEIIGSIKDELDPAFKEVSFFYSEENKPPDTEELDLETENMESIPLDPSSTLQPTDKHSG
HKAENGPGVVVLRASFEERQPYAHMNGGRKNERALPLPQSSAC
Download sequence
Identical sequences A0A218V095 H0ZEE4
ENSTGUP00000008956 ENSTGUP00000008956 XP_002199843.1.42559 XP_021408280.1.53032 59729.ENSTGUP00000008956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]