SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008981 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008981
Domain Number 1 Region: 1231-1310
Classification Level Classification E-value
Superfamily SMR domain-like 1.44e-19
Family Smr domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 22-151
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000342
Family Nucleotide and nucleoside kinases 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008981
Domain Number - Region: 22-74,615-713
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00478
Family Nucleotide and nucleoside kinases 0.035
Further Details:      
 
Domain Number - Region: 1068-1103
Classification Level Classification E-value
Superfamily UBA-like 0.0085
Family CUE domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008981   Gene: ENSTGUG00000008721   Transcript: ENSTGUT00000009078
Sequence length 1311
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:47871834:47892824:-1 gene:ENSTGUG00000008721 transcript:ENSTGUT00000009078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAQQPRVCHMMRKKMQLIGQVLVLLRGVPGSGKSYLARNLLKDNPGGIILSTDDYFYKHG
QYHYDPGCLGEAHDWNRKRAKEAFEMQISPIIIDNTNIQAWEMKPYVTLAQQFRYEVVFR
EPDTWWKFKPKELERRNIHGVSKEKIKRMLERYEHCLTVRSILDSSVPDKSEAAGWSEDP
CQEESQRLASFSSFVASNKRLKIEQWSLDKSIFTRLADLNEEGEIGSWENVLALCSSEKG
ILPKEIDKTSPSISLTLESSCDHEHFQKEEKEMENISVEHNSENSTVQDNLEINLSDCIK
RELPLETKEEKGLKTEENTEAEMDEVEVIPAEEIVELRYTVILTVSKFKLHNTVEPSREP
ELLNFLGDWPVEQTMGQRVKRSRRLEKSPLKNDKEGETPSQQHSEIGKEQVGLPETCTVE
KGHEDENLPCSCYSVSSDKAAPELQTGYWPVSASLEQREQRSRRMRKTNQCDEDRNTDDD
TNTNALETVHVIRGSPMNTEEQPDIRNLPVHQEEIVASEIVSEEKSQQSKRTKKHHKLAL
TFTNSSLPLPREEDHLSKLNLVEEKQEANLHRQKSSHSQTESQDFALLWRLEKKMLFPEK
TKVLHGRLDGFKPKDIDNVSDSQENIPYRVTYDKSTFVEESELINIDESEKLDTLCKLFE
SVSFEALKDLYERCNKDIDWATGLLLDSDEKLCKVVDTESFQVSKAEPVVADLDFKASKN
YDENQKDCKQTPQVFGAGDTFETSEGKDSSLNIAESRAAKTAVTSADVSDSFTATSLELN
NSVDSAPRTNTGSSAAGVDEVSVPGKQKREGESPPEEIVNKPSLLQLDAGLPHDPNTTST
NLKSELNNESDSNPSESNAKNSEGTGLSNKELEIDKETQENSKEICGKEEIDTPSWAATK
AKRQSPMPASHAAFSIDCLELTLPPELALQLKEIFGPVGIDAGSLTVEDCVVHIDLNLAK
VIHEKWKESILVMFQQIDTDDSEVLLSQNADSNIQKKKPSSAADTSNDTQTKTPATSDIF
PFMDHWNAQIQKVSLRQIISEEIAMQEREDLNRVPSTARKDCAAKLKEKQLFEMFPTINQ
NFLMDVFRDNNYSLEQTEQFLNCVLEADPVQTVIAQESVQQNEIVSSYSAAKNREKKAKK
SKEEDDPLCEMFQDFEYPQYDDLRAEAFCHQQKRQECLKKAGEAYRMGMKPVAAFYAHQG
RLHEQKMKEANHAAAVQIFERVNTSLLPMNVLDLHGLHVDEAVHQLSRVLQEKSEEYQQT
GGKPYLSVITGRGSHSQGGVARIRPAAIRYLTSHNFRFTEIKPGCLKVMLN
Download sequence
Identical sequences H0ZEG9
ENSTGUP00000008981 ENSTGUP00000008981 59729.ENSTGUP00000008981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]