SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009074 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009074
Domain Number 1 Region: 32-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-34
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 162-286
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-19
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 3 Region: 284-320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009074   Gene: ENSTGUG00000008802   Transcript: ENSTGUT00000009171
Sequence length 513
Comment pep:known_by_projection chromosome:taeGut3.2.4:11:13820693:13849145:1 gene:ENSTGUG00000008802 transcript:ENSTGUT00000009171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVTILVVEGIAVAQKTQGGQSIGVNRIPPTQCDNWVRTSNGGHFASPNYPNMYPPNQEC
IYILEAAPRQRIELTFDEPYYIEPSFECRFDHLEVRDGPFGFSPLINRYCGLKSPALIRS
TGRFMWIKFISDEELEGKGFQAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQ
VEQEGKTKPGQAVDCIWTIKATPNAKIYMRFLDYQMEHSNECKRNFVAVYDGSSSIENLK
AKFCSTVANDVTLQTGTGVVRMWADEGSRLSRFRMLFTSFVDPPCSGNTYFCHSNMCINN
SLVCNGIQNCAYPWDENHCREKKKTGLFEQITKTHGTIIGITTGIVLVLLIISILVQVKQ
PRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELENYQKLRRPSTAS
RCIHDHHCGSQASNIKQSRSNLSSMELPFRNDFAQPQPMKTFNSTFKKSTYTFKQAHDCP
EQVIEDRVMEEIPCEIYVRGREDTAQGSLSIDF
Download sequence
Identical sequences H0ZER2
ENSTGUP00000009074 ENSTGUP00000009074 59729.ENSTGUP00000009074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]