SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009170 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009170
Domain Number 1 Region: 6-81
Classification Level Classification E-value
Superfamily PDZ domain-like 8.41e-21
Family PDZ domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009170   Gene: ENSTGUG00000008912   Transcript: ENSTGUT00000009269
Sequence length 209
Comment pep:known_by_projection chromosome:taeGut3.2.4:18:9108471:9113551:-1 gene:ENSTGUG00000008912 transcript:ENSTGUT00000009269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLQEELRPRLCHMKKGPDGYGFNLHSDKTRPGQYVRAVDPGSPAEAAGLAPQDRIIEVNG
VCMEGKQHSDLRAPCQAGGAEVGKFMALGCSLAGGQNKHTLTQCPCPYPTGPLPEPVANG
DIGKENGGEPRSHSVSESPASPTALSPNSSETHSEVGLGEGDKRHSASGSLLDLDIPLAV
AKERAHQKRTSKRAPQMDWSKKNELFSNL
Download sequence
Identical sequences H0ZF08
ENSTGUP00000009170 ENSTGUP00000009170 59729.ENSTGUP00000009170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]