SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009218 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009218
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.08e-18
Family Txnl5-like 0.0000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009218   Gene: ENSTGUG00000008942   Transcript: ENSTGUT00000009317
Sequence length 121
Comment pep:known_by_projection chromosome:taeGut3.2.4:19:11470904:11473327:-1 gene:ENSTGUG00000008942 transcript:ENSTGUT00000009317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREEAQVREYHEIRGAAQRYRRPIFALFCGEKDAEDRSWCTDCVTAEPIVRKELHNLPD
ESVFIYCLVGDRAYWKDPNNEFRTNLKLTGVPTLLKYGTPQKLVEEECFKAELVRMLFTE
D
Download sequence
Identical sequences H0ZF56
59729.ENSTGUP00000009218 ENSTGUP00000009218 ENSTGUP00000009218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]