SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009269 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009269
Domain Number 1 Region: 85-417
Classification Level Classification E-value
Superfamily Subtilisin-like 2.88e-94
Family Subtilases 0.000000000931
Further Details:      
 
Domain Number 2 Region: 414-564
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-43
Family Proprotein convertase P-domain 0.0000965
Further Details:      
 
Domain Number 3 Region: 608-769
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.68e-31
Family Growth factor receptor domain 0.00027
Further Details:      
 
Domain Number 4 Region: 1-68
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 5.78e-17
Family Prohormone convertase 1 pro-domain 0.0024
Further Details:      
 
Domain Number 5 Region: 742-854
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000209
Family Growth factor receptor domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009269   Gene: ENSTGUG00000008972   Transcript: ENSTGUT00000009368
Sequence length 883
Comment pep:known_by_projection chromosome:taeGut3.2.4:10:18202234:18234315:-1 gene:ENSTGUG00000008972 transcript:ENSTGUT00000009368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WAGRIRGGPAEAARLAAAYAYIRLGQIGSLENYYHFHHSKTFKRSTLSSRGPHNFLRMDP
KVDWLQQQEVKRRVKRQVRGEPHALPFNDPVWPNMWYLHCGDKNSRCRSEMNILAAWQRG
YTGKNVVVTILDDGIERNHPDLLQNYDPLASYDVNGNDHDPTPRYDASNENKHGTRCAGE
VAAAANNSYCIVGIAYNARIGGIRMLDGDVTDVVEAKSLGIRPDYIDIYSASWGPDDDGK
TVDGPGLLAKQAFEQGIKKGRRGLGSIFVWASGNGGREGDYCSCDGYTNSIYTISISSTT
ENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRHRCTDGHTGTSVSAPMVAGIIALA
LEANPLLTWRDVQHLLVKTSRPGHLRAPDWKTNGAGHKVSHLYGFGLVDADAIVVEAKKW
RMVPPQHVCVGSLDRVPKYIRADHVLRASTLSSACAEQRDQHVLYLEHVVVRLSIAHPRR
GDLQISLISPAGTRSQLLARRVFDHSNEGFKGWEFMTVHCWGERAAGEWTLEIHDTPSQV
RNPAVQGKLKEWSLIFYGTGEHPYTALSGPQSRGRSLEVPTSEMEPSRAAFLQSQVEVAE
EEEEYAGPCHPECGDQGCDGPNADQCLNCIHYSLGSMKTGRMCVSSCPAGFFGDNGARRC
RRCHKGCERCVGRGPSQCTACKRNLYHHPEMGTCVLLCPPGFYAEERQKRCLKCHQSCKK
CVGEADKCTACKEGFSLAGESCVPECQPAMYLSREPRRCETCPASTARCFRPGEEDCTPC
TPEGPAPHWRCVPACREGFYPADSHGLPNKVCKRCDDHCSACEGSSNCLRCKEGYSLLGG
SCVTNETCTKCTDKTFCEMVKSNKLCEKKLFVQFCCQTCLMAG
Download sequence
Identical sequences H0ZFA7
ENSTGUP00000009269 59729.ENSTGUP00000009269 ENSTGUP00000009269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]