SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009278 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009278
Domain Number 1 Region: 1170-1235
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.79e-21
Family TB module/8-cys domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 511-578
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.23e-19
Family TB module/8-cys domain 0.00053
Further Details:      
 
Domain Number 3 Region: 1344-1403
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.1e-17
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 4 Region: 952-1072
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 5 Region: 708-832
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000518
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 387-455
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000068
Family TB module/8-cys domain 0.0034
Further Details:      
 
Domain Number 7 Region: 454-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000252
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 8 Region: 901-948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000753
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 9 Region: 1065-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000157
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 1447-1531
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000502
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 1286-1331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000216
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 12 Region: 237-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000174
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 827-866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000036
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 14 Region: 1248-1294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000272
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009278
Domain Number - Region: 25-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00105
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1113-1140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0163
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009278   Gene: ENSTGUG00000008923   Transcript: ENSTGUT00000009377
Sequence length 1534
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:36587151:36769948:1 gene:ENSTGUG00000008923 transcript:ENSTGUT00000009377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNVCGGQCCHGWSKATGSQRCIKPNCAPPCQNGGMCLQPQLCVCKPGTKGNSCEDTVVQD
TSSTGGWSPVVPPWPIPQQAAQQTFSQKVQVPPKVSPMAQMAFTIKQKPPVGLTQQMQPQ
MIPLSSQTLMMNLHHGQTQEYVIKPKYYPVKKVISGEQSTEGSLPLRLGQDQAASPLRLG
NHTGRIKVVFTPSICKVTCTKGNCQNNCEKGNTTTLISENGHAADTLTATNFRVVICHLP
CMNGGQCSSRDKCQCPPNYTGKLCQIPVQTASSPKLYHHPQQVNKAVGSQVIHSTHTLPL
TMSGQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDSISTGQKAKVPQPVHPQVSYQG
LPYQKAQKGHTTYTNQQPIPHMFPVSVKTQLGRCFQETVGTQCGKALPGLSKQEDCCGTV
GTSWGFNKCQKCPKKPSYHGYGPMMECPQGYKRINATFCQDINECQLQGVCPNGECLNTM
GSYRCTCKMGFVPDPTLSRCIPDNPVVAEEKGPCYRFVSAGKQCMHPLSVQLSKQLCCCS
VGKAWGPHCEKCPLPGTAAFKDICPGGMGYTVSGPHRNKLYHHPAPPAIGKTPITQPVAK
GTSPPPLPAKEEPVEALTFSQKRPRGTTPHSRTFHDAQCELASIDQEKQPYLEPGQPQLS
PGISTINLQPQFPVVIEKTSPPLPVEVAPEVSTSSASQVIAPTQVTEINECTVNPDICGA
GHCVNLPVGYTCICYKGYKLNDQQTKCIDINECDQAPHLCSLGRCENTEGSFLCICQAGF
MASEDGTDCIDFDECSRPYTCGEGFCINTLGSYRCEYCDSGYQMNRRGECEDIDECLTPA
TCPDAQCLNAPGSYQCIPCRVGFRGWNGQCHGMFSTLCLSACSSCSEVLGNLLISCTFFL
FTDINECQYGNHCTNGRCENTEGSFRCFCAQGFKLSASKDQCEDINECQQRSVCTNGRCR
NTEGSFRCICSQGYSLSSTGDQCEDVDECLQDSNVCLRGSCINTEGSYKCTCPDGFQQIA
NRGCQDINECERSDLCSPHGECLNTDGSYQCICERGFSVSADGRTCEDVDECTNGTVCGT
HGFCENMDGSYRCLCYQGYQDTQDGQGCTDVNECEMLSGVCGEALCENVDGSFLCLCSDE
NQEYDPMTGQCRLRTSPEMPIEADQQEDGKKECYYNLNDANFCDNVLTSNVTKQECCCTL
GAGWGDNCEIFPCPVVGTAEFTDLCPEGKGFIPSGESSYGLLAQNYKDADECQLFGQEIC
KNGFCLNTQPGYECYCKQGTYYDPVKLQCFDTDECQDPNSCIDGQCINTEGSYNCFCTHP
MVLDTTEKRCVRPADSSEQTEEAEVYQDLCWQHLSDDFVCSRPLVGKQTTYTECCCLYGE
AWGMQCALCPMKESEDYAQLCNIPVPGSRRPYGQDALVDFEEHYTPETNPYFVEDRFLNS
FEELQAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDMAKMTCVDVNECNELNNRMSLC
KNAKCINTEGSYKCLCLPGYVPSDKPNYCTPLNS
Download sequence
Identical sequences H0ZFB6
ENSTGUP00000009278 ENSTGUP00000009278 59729.ENSTGUP00000009278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]