SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009311 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009311
Domain Number 1 Region: 495-641
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.31e-44
Family Toll/Interleukin receptor TIR domain 0.000000223
Further Details:      
 
Domain Number 2 Region: 200-442
Classification Level Classification E-value
Superfamily L domain-like 1.13e-34
Family Ngr ectodomain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009311   Gene: ENSTGUG00000009041   Transcript: ENSTGUT00000009410
Sequence length 653
Comment pep:novel chromosome:taeGut3.2.4:4:48357924:48359885:1 gene:ENSTGUG00000009041 transcript:ENSTGUT00000009410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQNTSFLRNVFLYKCLFALTFWSYISLSVEDELFTSVSNNFPEDDSNQKIKSLPLLYTN
SNQSKADFDWVVIQNTTESLSLSEITNDNVKKLIALLSNFTQGSRLQNLTLTNVSVDWNA
LMEIFQTVWHSSIQYFNTNNVTQLSDIESYDFDYSGTSMKALTMKKIIITDMYFTQDDLY
KIFADMNIEHMTIADSEMIHMLCPSSRSPFRYLNFLKNDLTDFLFQNCDNLLQLEILILQ
KNKFESLRKVSFMTSRMKSLKYLDMSNNLLRHDGADVQCQWAESLTELDLSSNQLADVVF
ECLPVNIKKLSLQNNQISNVPSGVAELKSLEELNLASNRLADLPGCSGFTSLQFLNVEMN
SILTPSADFFKSCPKVRELQAGHNPFKCSCELQAFIRLERRSGGKLFGWPVAYVCEYPEG
LRGTELKDFHLSLLACNTTLLLVTALLLTLLLVAVVAFLCIYLDVPWYVRMTWQWTQTKR
RARHNPPGDQGAVLQFHAFISYSERDSLWVKNELIPNLEKGEGCIQLCQHERNFVPGKSI
VENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHKLFSENSNSLILILLEPIPPYLI
PARYHKLKALMAKRTYMEWPKERSKRALFWANLRAAININLPKADENLSEETD
Download sequence
Identical sequences H0ZFE9
ENSTGUP00000009311 XP_004176651.1.42559 59729.ENSTGUP00000009311 ENSTGUP00000009311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]