SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009346 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009346
Domain Number 1 Region: 2035-2227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.1e-31
Family Laminin G-like module 0.0077
Further Details:      
 
Domain Number 2 Region: 1783-2009
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-31
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 3 Region: 1285-1420
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-31
Family Cadherin 0.0007
Further Details:      
 
Domain Number 4 Region: 211-320
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-26
Family Cadherin 0.0025
Further Details:      
 
Domain Number 5 Region: 746-861
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 425-533
Classification Level Classification E-value
Superfamily Cadherin-like 5.23e-25
Family Cadherin 0.00086
Further Details:      
 
Domain Number 7 Region: 861-961
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 958-1080
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-24
Family Cadherin 0.0009
Further Details:      
 
Domain Number 9 Region: 1070-1182
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-23
Family Cadherin 0.00038
Further Details:      
 
Domain Number 10 Region: 313-439
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-22
Family Cadherin 0.0032
Further Details:      
 
Domain Number 11 Region: 529-654
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-22
Family Cadherin 0.0057
Further Details:      
 
Domain Number 12 Region: 1178-1302
Classification Level Classification E-value
Superfamily Cadherin-like 3e-20
Family Cadherin 0.0009
Further Details:      
 
Domain Number 13 Region: 1397-1515
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-17
Family Cadherin 0.01
Further Details:      
 
Domain Number 14 Region: 119-223
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-16
Family Cadherin 0.0027
Further Details:      
 
Domain Number 15 Region: 10-103
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000171
Family Cadherin 0.002
Further Details:      
 
Domain Number 16 Region: 637-753
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000157
Family Cadherin 0.0023
Further Details:      
 
Domain Number 17 Region: 1506-1606
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000214
Family Cadherin 0.031
Further Details:      
 
Domain Number 18 Region: 2272-2311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000908
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009346
Domain Number - Region: 2230-2258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0166
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009346   Gene: ENSTGUG00000009048   Transcript: ENSTGUT00000009445
Sequence length 2395
Comment pep:novel chromosome:taeGut3.2.4:11:16075296:16119323:-1 gene:ENSTGUG00000009048 transcript:ENSTGUT00000009445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWYLVHVSLTVTDVNDNVPEWAMEPFPFLAVVSPEAAGGTEVYKLLAVDADEGIHGTVEY
FLLEGGQDRFEVEKDTGWIKTTGLPLVRDKEYLLTVLAADKLGSRGSPASVSVIAGFRPP
QFTNISYFVYVPESTPQGEPFLTVTAVSYQKKSLSYSLLTNPGGLFSIDQATGELSLTRS
VDYEGDSHQYLLLVRAEENEGQFSTAAEVLVVITDVNDCAPAFHQSIYSKVGVPETVPMT
TALLQVTATDCDSKENAQLLYYTLSQDFSITSHGTIFPATRLDYERPEHLYEFIIMAVDQ
GEEPRTGTATVRIHVSNVNDEAPEFSQTVYRSFVSEDAGPNTLIATVNAVDPDGDGVTYD
ILSGNQKGNFVIDPKKGLVRLRASPFPELQGTEYVLNVTATDDNASGGPHPLTSTAQVVV
KIDDVNNNKPVFQKCQYYREHASVLENQPSGTVVLQVEATDADEGTNGIVKYGLMHRDGV
LPAFSIHPDTGVLTTLQVFDREKQREYPITVTATDQAAEPLIGICQINIVILDQNDNDPR
FENTHYEYFLREDTRVGTSFLRVAARDDDYSSNAAITYSIASDEPNYLQIHPTTGWVFVN
QPISQKTSIIREITATDGGNRSSKVELAVTVTSAENQPPQWERDSYEVVIPENTTRDASI
LTIKATSPLGDPRVTYNLEEGLVPEANMPVRFYLTPNRHDGSASVLVAESLDYETTKSFQ
LRVRAQNVAAVPLAAFTTVHVNVTDVNDNVPFFTSSIYEASVTEGADVGTFVTQVSATDL
DVGQHGEITYSLLHDSGRDYTCFRLDPRTGSIYTTSVFDREEKGSYLLEVKSMDGSESAR
PGKHGKPNSDTAYVRVSVSDVNDNQPVFAQSVYEVSVDEDQDVGSTILTVSANDEDEGTN
AKLRYQITAGNTGGVLDVDPETGAIVIAQPLDYEDTKMYEIHLLASDGKWEDYAVIIINI
MNKNDEAPVFSINEYYGSIIEELDLLPVFVLQVMASDPDSGVDGGDLRYSLHGYGAADIF
TIDEKIGSIYSHKRLDREERALWRFIVLATDEGGGGLTGFADVIINVWDINDNAPMFTCM
PDDCSGNVFENSPADTLVMEMAAVDRDDPNVGLNAVLTYRITENVKNEFGTDMFNINPST
GTIHVAGGLLDRERTESYFLTVEARDGGGLTGTATATVWVADVNDNVPKFTKKLWQAAVP
ENSAIDSAVLQVCATDADIGENADLVFSIIGGDPDEKFYIENDKEWQCGTVRLKKLDFEN
ARERQFNLTITVEDLDFSSVAVCLIEVEDSNDHSPAFLSQFIQTNPVFEDVPVGTTVTTV
KATDKDSDFNGKVIYSIKSDSDPMTQFVVDQFGHVVVASALDREAIQKYALIVQAADQGT
PARTGSVTVLINLLDINDNGPRFEAPYMPVVWENTLKPEIVHMNHTSKLLHASDPDAEEN
GPPFTFSLPPEYQNSLDFSLTDNRNNTATITALRSFDREKQKVFHLPIVITDSGIPAMSS
TTTLTITVGDENDNCHEPGHKEVYVYSYKGKWSTTVLGEVFAPDQDDWDNKTFLSEGKLL
KSFRLNQRTGSLLMVDYTPQGIYNLRVRVSDGVCPDVISTVQVHVRDLENEAVQNSATVR
FSGVTAEEFIRRDEHGKTRHGELKEFLAKLLPAKLSDVIVFSVMGRDGRQTDVRFAVRAG
PAYYRPEKLHAEMAAFKTEMQSALQLNISQIDVDECRSANCSEGCTNHLSVSDIPTVMDT
GSVSFVSLSTSSHGLCSCSARERLHQPCSSYPRSPCLNGGLCVDTLNGYRCLCPASFHGP
DCQQTKHSFHGNGYAWFRPIRPCFESSLSLEFITVVPDGLLLYSGPLSNPEPGSTENFIA
IELSGGIPVLKMSHGSGSVVLQFPSHLNVADKKWHRLEVRTNGQVNIYLLANAVTGLIKR
TGRPQPFVLGSVQEVEAEMGAAGASWVYLNVNPVLQLGGVKESLPYSYPQLLHKHFSGCL
RNFILDTQVYDLQFPAESLNSFPGCTLTDGSCETMGSSSCGAHGRCLGDWGSFACHCLPG
YHGYRCDKVAKEYRFEAGSHIRYQLPVSVSARRTLLQALVRTRQPHGVIATVLSRARDEH
ITLQVVQGLLVVSYNLGDGNYSVSLPSYHIDNGEWHHITLERNENEFTLRLYEGGGKREI
TKAAGIYKEIVIDPSSLVLGNTYPFNQNKSFQGCMKDVRFNNYRLPLDTHGKELVSVLSA
QGIKEGCSSEACRNNPCNQEFICIDLWMMHECSCPAGHMLLENASGRQCVYTACAERPCN
YGTCVSLSPSTFQCHCPDGYAGRRCEITLAIFHKDTGLSFTSLFAICVCFLALLALLSAA
FLWAHWKTRKGLHGGIYHGSAHPEDLEDIRENILNYNEEGGGEQDEDAYDMAELQ
Download sequence
Identical sequences H0ZFI4
ENSTGUP00000009346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]