SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009397 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009397
Domain Number 1 Region: 209-448
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.16e-83
Family Eukaryotic proteases 0.00000164
Further Details:      
 
Domain Number 2 Region: 18-81
Classification Level Classification E-value
Superfamily GLA-domain 1.22e-23
Family GLA-domain 0.00031
Further Details:      
 
Domain Number 3 Region: 106-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000165
Family EGF-type module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009397   Gene: ENSTGUG00000009098   Transcript: ENSTGUT00000009496
Sequence length 448
Comment pep:novel chromosome:taeGut3.2.4:1:25958302:25975807:1 gene:ENSTGUG00000009098 transcript:ENSTGUT00000009496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVFLKQEEASNVLERRRRANSFFEEIKLGSLERECIEELCSYEEAREIYGDLERTEEFWH
TYSDGNQCSSNPCHYGGHCKDGIGSYTCTCLDGYQGKNCEFVIPKFCKINNGDCEQFCSV
QRDGRKDVLCSCADGYVLAEDGKQCVATVKYPCGKVSVVRKKRSVLSPTDHSNGTSDQED
PPTNMSAEEDFAITTESPTPPPDNRTSGKTPYVDTRIVGGDECLPGQCPWQAVLLNEEGE
EFCGGTILNENFILTAAHCINQTKEINVVVGEVDREKKEQSESMHTVDKILVHSKFIAET
YDNDIALLKLKEPIRFSEYVIPACLPKADFANEVLMNQKSGRVSGFGREFEGGRTSKKLK
VLEVPYVNRNTCKQSTNLAITENMFCAGYDTEQKDACQGDSGGPHVTRYKDTYFVTGIVS
WGEGCARKGKYGVYTKLSRFLRWVRTVM
Download sequence
Identical sequences H0ZFN5
59729.ENSTGUP00000009397 ENSTGUP00000009397 ENSTGUP00000009397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]