SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009401 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009401
Domain Number 1 Region: 4-214
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.18e-74
Family Eukaryotic proteases 0.00000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009401   Gene: ENSTGUG00000009127   Transcript: ENSTGUT00000009500
Sequence length 214
Comment pep:novel chromosome:taeGut3.2.4:1:25984289:25985688:1 gene:ENSTGUG00000009127 transcript:ENSTGUT00000009500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAVLLNEEGEEFCGGTILNENFILTAAHCINQTKEIKVVVGEVDREKKEQSESMHTVDKI
IVHSKFDAETYDNDIALLKLKEPIRFSEYVIPACLPKADFANEVLMNQKSGRVSGFGREY
DGGQLPKKLKVLALPFVNSTTCKQSTSFVVTENMFCAGYDTEEKDACQGDSGGPHVTRYK
DTYFVTGIVSWGEGCARKGKYGVYTKLSRFLRWV
Download sequence
Identical sequences H0ZFN9
59729.ENSTGUP00000009401 ENSTGUP00000009401 ENSTGUP00000009401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]