SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009480 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009480
Domain Number 1 Region: 43-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-32
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 2 Region: 163-285
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-18
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Domain Number 3 Region: 284-320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009480   Gene: ENSTGUG00000009188   Transcript: ENSTGUT00000009581
Sequence length 526
Comment pep:known chromosome:taeGut3.2.4:2:97858703:97917222:1 gene:ENSTGUG00000009188 transcript:ENSTGUT00000009581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVVASLIILHFSVATKKGTEKQTVSEGQRPVQCGTWTKYAEGGIFTSPNYPNKYPPDRE
CVYIIEAAPRQCIELHFDEKYSIEPSWECKFDHIEVRDGPFGFSPILGRFCGQQNPPMIK
SSGRFLWIKFFADAELESIGFSARYNFTPDPDFKDLGVLKPLPVCEFEMGGPEGIVESVQ
IVKEGKASETEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGSSSVEDLK
AKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEANTFFCHSNMCINN
TLVCNGLQNCVYPWDENHCKEKRKANLLDQLTNTSGTIIGVTSCIVIILIVISIIVQIKQ
PRKKFVQRKTDFDQTVFQEVFEPPHYELCTLRGTGTTADLADVADDFENYHKLRRSSSKC
IHDHHCGSQVSSIKGSRSNLSTRDASVLTEIQPQPVKPLVQPMNRRNILVMKHSYSQDAA
DACEIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences H0ZFW8
ENSTGUP00000009480 59729.ENSTGUP00000009480 ENSTGUP00000009480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]