SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009569 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009569
Domain Number 1 Region: 615-815
Classification Level Classification E-value
Superfamily HCP-like 1.83e-28
Family HCP-like 0.00092
Further Details:      
 
Domain Number 2 Region: 833-943
Classification Level Classification E-value
Superfamily HCP-like 0.00000000589
Family HCP-like 0.009
Further Details:      
 
Domain Number 3 Region: 511-580
Classification Level Classification E-value
Superfamily HCP-like 0.0000562
Family HCP-like 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009569
Domain Number - Region: 230-368
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000633
Family Galectin (animal S-lectin) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009569   Gene: ENSTGUG00000009265   Transcript: ENSTGUT00000009671
Sequence length 1030
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:52563880:52591098:1 gene:ENSTGUG00000009265 transcript:ENSTGUT00000009671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFVVSFGKETLQTTAITPQFQKNMDYVDFIYLNILEKKVLNNSEVSVQYLCSKPCIVNLE
AVASSEFRTGVPVYRRRWKDEKNLYVSRTRQVHLKFPSIMVYRDDYIIRNSIIVHSVILY
AWISHKSASNYDDEQNEDYQAAVAKNYTFLEAVPPFERPYKDHKVCLQWGADYLWMLQAN
RIPQCPHESDGVQVLEFIYASSGEKTGIVKKFEQFENRELETVRQHQIDYPMFTISIWLY
LLHHCEKDLCGILYFIDSKEMYGTPAVFLNEEGYVHIQMHLVRGDDLAVKTSFSLPLKQW
FRLDLSFKGGQIEVSSVGKNLKRHHHQSFTFREDFYYDDTGGYFVLGGSGYVNGIEAFFG
PVKYYRLNVLETEQISNPLHDKDTVEQIELYYERCMDIQEIVYDYRYIVRQGEKAHRSCY
YENYYLELIHKYGEKSKCDAFMWGKELREKYHTLFKLLQEMDFSSPDEDGSDTVVEVGQR
IFEKVVKGLSSANGLNNLGSSVPLLVDSSCCGYHKASYFLAVIFETGLGVPVDRIKGLLY
SLVGAQGNERLSVMNLGYKHYQGINNYPLDLELSYAYYSNIAIKTSLDQHNIKGEQAFVE
TIRLMDDELLKAQTKENGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKNPEAAIEW
YAKGAIETEDPVLIYDYAIVLFKGQGVKKNIKLALELMKKAAAKGLPQAVNGLGWYYHNF
KRDYRKAAKHWLIAEELGNPDASYNLGVLYLDGIYPGVPGRNQTVAARYFYKAAQGGHIE
GTLRCSLYYITGNMEDFPRDPEKAVIWAKHIAEKNGYLGHVIRKALNAYLELSWHEALLH
YILAAETGIEVSQSNLAHICEERPDLARKYLATDCVWRYYNFSVSQVNAPSFAYLKMGDF
YYYGYQNQSKDLELSMRMYAQAALEGDSQGFFNLALVMEEGNSIPSYILDHLEIDQALHS
SNTSLLQELYYRCWNNSNQESISPCSLALLYFYMRVLWNNVLHSTLIYFMGTFILSILVA
FAVQSFQSLS
Download sequence
Identical sequences H0ZG57
ENSTGUP00000009569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]