SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009633 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009633
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-21
Family APC10-like 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009633   Gene: ENSTGUG00000009350   Transcript: ENSTGUT00000009736
Sequence length 104
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:22764775:22766757:-1 gene:ENSTGUG00000009350 transcript:ENSTGUT00000009736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSKTFWTTTGMFPQELIIGFPKCVKISKVAIQCYLVRTLRIERSTSEDPVGFEQCVEKDL
QHREGQLQMEEFTLPEFQATYLRFIIKSGFDHFVSVHRVMAEGT
Download sequence
Identical sequences H0ZGC1
ENSTGUP00000009633 59729.ENSTGUP00000009633 ENSTGUP00000009633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]