SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009645 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009645
Domain Number 1 Region: 35-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000089
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 2 Region: 84-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009645
Domain Number - Region: 121-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0017
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009645   Gene: ENSTGUG00000009361   Transcript: ENSTGUT00000009749
Sequence length 161
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:22781881:22783902:-1 gene:ENSTGUG00000009361 transcript:ENSTGUT00000009749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAVVLLVLVAAVASGVAALALLPRAPANRLCTAPNNRTGFLCDDRVTCVPASWVCDRVSN
CRNGEDEQEQFCGDLPHSLPGYLVFYCSSPRSWVYADQRCNGMNDCGDCSDETWGSAACP
PCGQEWWSCSPAHFQFCSCIPRRLCRDGTQHCLDWSDEFLC
Download sequence
Identical sequences H0ZGD3
59729.ENSTGUP00000009645 ENSTGUP00000009645 ENSTGUP00000009645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]