SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009655 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009655
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.05e-18
Family Ubiquitin-related 0.00012
Further Details:      
 
Domain Number 2 Region: 409-453
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000318
Family RING finger domain, C3HC4 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009655
Domain Number - Region: 323-373
Classification Level Classification E-value
Superfamily RING/U-box 0.00671
Family IBR domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009655   Gene: ENSTGUG00000009367   Transcript: ENSTGUT00000009759
Sequence length 462
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:37384893:37971173:-1 gene:ENSTGUG00000009367 transcript:ENSTGUT00000009759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFVRFNSSHGFPVEVGSDSSILQLKEAVAQRQGVPADQLRVIFAGRELSNDLTLQNCDLA
QQSIVHIVESPQKNSQDKEKTEYSCVGGVPKALKREPESLTRIDLSTSILPSVSAGLAVI
LDPGKNSVSLPSEKSAGAASYNSFYVFCKNFCQAVKPGKLRVRCSVCKQGTLTLARGPSC
WDDVLIPNRIGGVCQSQGCNGNVAEFYFKCGAHPTTDSETSVALNLVTTNSRCITCITCT
DIRSPVLVFQCVHRHVICLDCFHLYCVTMLNDRQFIHDPELGYSLSCVAGCPDSLIKELH
HFRILGEEQYNRYQHYGAEECVLQMGGVLCPTPGCGAGLLPEPDLRRIVCEPGNGIGCGS
VFCRECKEEFHEGECNSLLSPPGAMAQGYVVDEHAAMQARWEEASRETIKKTTKPCPNCN
IPVEKNGGCMHMKCPHPQCRFEWCWNCGLEWNRTCMGDHWFE
Download sequence
Identical sequences H0ZGE3
59729.ENSTGUP00000009655 ENSTGUP00000009655 ENSTGUP00000009655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]