SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009676 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009676
Domain Number 1 Region: 142-249
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-26
Family Cadherin 0.00035
Further Details:      
 
Domain Number 2 Region: 360-482
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-24
Family Cadherin 0.0034
Further Details:      
 
Domain Number 3 Region: 252-364
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 470-578
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-18
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 61-149
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000003
Family Cadherin 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009676   Gene: ENSTGUG00000009319   Transcript: ENSTGUT00000009781
Sequence length 779
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:100683491:100719815:1 gene:ENSTGUG00000009319 transcript:ENSTGUT00000009781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSVLLRLMVMLVQLWPCSLSTQNSSAQNTVQSFIPVRRVKRSWLWEPLFVTEEQISPD
PVYIGQLKSDLDKQDGNLKYILTGEGAGSFFVIDELNGKIYVTQKLDREKKPFYTLRAQA
INRITKLPVEPESEFIIKVRDVNDNEPQFLDGPYVATVPEMSPEGTSVTQVTATDADDPS
YGNSARLLYSLLEGQPYFSVEPKTGVIRMASQMDRETKEQYLVIIQAKDMVGQPGALSAT
ATVTINLSDINDNPPEFQQRLYYMSVSEEAPVGTTVGKVFAEDRDTGDNTAMDYFIEADS
SGVFDIITNNETQEGIILLKKRVDYESQRRYSIQVKAVNRYIDERFLKEEPFEDTTIVKI
NVEDADEPPVFTLENYMMEIVEGAMNGALVGFVTARDPDDDESPIRYSIVHSTHLKRLFS
INEHNGAIITTEPLDREIASWHNITVTATETRNPEKISETNVYVQVLDVNDNAPEFPKNY
ETFVCENTVSGQLIQSISAVDQDDSAEGHHFFFSLAQEDTNSSHFTVKDNQDNTAGIFTG
KSGFSRQEQFFFYLPILIQDNGTPPLTSTNTLTVTVCDCDTEVNTFYCRYGAFMYSLGLS
TEALVALLACILIFLVFFLAIVTIRQQQQKKAPFSEKMEEFRENIVSYDDEGGGEADTEA
FDISALRTRTVMRTHKPRKKVASEIQSLYRQSLQVGPDSAIFRQFISEKLEEANTDPSVP
PYDSLQTYAFEGTGSLAGSLSSLGSNTSDMDQSYDYLADWGPHFKQLAGMYSSHRTVGD
Download sequence
Identical sequences H0ZGG4
XP_002191433.1.42559 59729.ENSTGUP00000009676 ENSTGUP00000009676 ENSTGUP00000009676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]