SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009681 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009681
Domain Number 1 Region: 18-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-36
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 2 Region: 253-363
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-32
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 3 Region: 137-245
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-32
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009681   Gene: ENSTGUG00000009399   Transcript: ENSTGUT00000009786
Sequence length 366
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:22815148:22816779:-1 gene:ENSTGUG00000009399 transcript:ENSTGUT00000009786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPGKGTSHLLLCPPGIKCGGVLSAPSGNFSSPNFPGLYPYETECTWLIVVAEGSSVLLSF
SHFELEYHDTCAYDYLQVYNGAARDRGNLLGTFCGHRPPPPFSSAWHVMAVVFRSDRHVA
KHGFAAAYRKDACGGQLTGLSGEITSPRYPESYPNDAECRWSIGGAGGGGPLTLVFADFQ
MEGGQGCGFDYVALFDGPTVTAPGLGRYCGSARPPRTVSSTPHLLIIFKSDFNIGGRGFK
AHFYSAGECQEVFTTIKGNFSSPQYPNFYPNNLKCQWSIHLPPGYRVKVFFLDMELEGRS
SLTGGCDYDHLSAFDGGTENGSLLGRWCGRESLAPVTSRSNRLLLVLHTDRDMAKRGFSI
SYVGGK
Download sequence
Identical sequences H0ZGG9
ENSTGUP00000009681 59729.ENSTGUP00000009681 ENSTGUP00000009681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]