SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009721 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009721
Domain Number 1 Region: 146-254
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-25
Family Cadherin 0.00032
Further Details:      
 
Domain Number 2 Region: 366-485
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-25
Family Cadherin 0.0034
Further Details:      
 
Domain Number 3 Region: 255-371
Classification Level Classification E-value
Superfamily Cadherin-like 5e-23
Family Cadherin 0.0007
Further Details:      
 
Domain Number 4 Region: 475-584
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 70-153
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000034
Family Cadherin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009721   Gene: ENSTGUG00000009395   Transcript: ENSTGUT00000009827
Sequence length 785
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:101000068:101073401:-1 gene:ENSTGUG00000009395 transcript:ENSTGUT00000009827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGKVEFCHFLQILALFLCLSGMNQAEITRSRSKPYFQSGRTRTKRSWVWNQFFVLEEY
MGTDPLYVGKLHSDVDKGDGSIKYILSGEGASSIFIIDENTGDIHATKRLDREEQAYYTL
RAQALDRLTNKPVEPESEFVIKIQDINDNEPKFLDGPYTAGVPEMSPVGTSVVQVTATDA
DDPTYGNSARVVYSILQGQPYFSVEPKTGVIKTALPNMDREAKDQYLLVIQAKDMVGQNG
GLSGTTSVTVTLTDVNDNPPRFPRRSYQYNVPESLPVASVVARIKAADADVGPNAEMEYK
IVDGDGLGVFKVSVDKDTQEGIITIQKELDFEAKTSYTLRIEAANIHVDPRFLSLGPFSD
MTTVKIIVEDVDEPPVFTSRLYSMVVSEAAKVGTIIGTVAAHDPDASNSPVRYSIDRNTD
LERYFNIDANSGVITTAKSLDRETNAVHNITVLAMESQNPAQIGRGYVAITILDINDNAP
EFAMEYETTVCENAQPGQVIQKISAIDKDDPPNGHQFYFSLTAEAANNHNFTLQDNKDNT
ATVLTKRNGFRRQEQSVFYLPIFIVDSGSPSLSSTNTLTIRVCDCDADGIAQTCNAEAYI
LPAGLSTGALIAILACVLTLLVLVLLIVTMRRRKKEPLIFDEERDIRENIVRYDDEGGGE
EDTEAFDMAALRNLNIMRDTKTRRDVTPEIQFLSRPTFKSIPDNVIFREFIWERLKEADV
DPCAPPYDSLQTYAFEGNGSVAESLSSLDSISSNSDQNYDYLSDWGPRFKRLADMYGTGP
ECLYS
Download sequence
Identical sequences H0ZGK9
ENSTGUP00000009721 XP_002187087.1.42559 ENSTGUP00000009721 59729.ENSTGUP00000009721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]