SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009807 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009807
Domain Number 1 Region: 19-216
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.91e-73
Family Noggin 0.0000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009807   Gene: ENSTGUG00000009521   Transcript: ENSTGUT00000009913
Sequence length 216
Comment pep:known_by_projection chromosome:taeGut3.2.4:18:10750391:10751041:1 gene:ENSTGUG00000009521 transcript:ENSTGUT00000009913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTIYALVVLLGLRLEQGACQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRS
LMGGHFDPNFMAVSLPEDRLGVDDLAELDLLLRQRPSGAMPSEIKGLEFYDGLQPGKKHR
LSKKLRRKLQMWLWSQTFCPVLYTWNDLGSRFWPRYVKVGSCYSKRSCSVPEGMVCKPAK
SVHLTILRWRCQRRGGQRCTWIPIQYPIISECKCSC
Download sequence
Identical sequences H0ZGU4
ENSTGUP00000009807 59729.ENSTGUP00000009807 ENSTGUP00000009807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]