SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009828 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009828
Domain Number 1 Region: 330-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-49
Family SPRY domain 0.00047
Further Details:      
 
Domain Number 2 Region: 32-82
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000259
Family B-box zinc-binding domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009828   Gene: ENSTGUG00000009536   Transcript: ENSTGUT00000009934
Sequence length 510
Comment pep:known_by_projection chromosome:taeGut3.2.4:18:10855881:10862244:-1 gene:ENSTGUG00000009536 transcript:ENSTGUT00000009934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVQTCVTCTASFCAEHLRPHRDSPAFRDHQLCPPLRDLQLRKCPQHNRLFEFFCSMHGVC
ICSLCLLGHKLCPTNPLEQAKATAQVSSRGWPGTPAALTLLQTVVLKPVPVCSCLPQETA
SRKKELIRNEFSEVKAVIEERENEIMKAIAEEEKRVWNKLDYIYSVLGNKKNEIQSLKDQ
IEMALTESDDVLFLKRAAALQRTSTKEAFVPVVEMDQNVMHSTYQSAITLKDKVKISVIQ
SRETKEEGTCNKYSQLIYTVFQSLQSSISTQKHYINPAWSRRLNQISSRLSLFPAGQTLC
SSVDTAPITTPSATAAAAKDLIDSFLKKPREELLQYAANITLDYNTAHSTVVLAENYTRM
SISDTFPGHKYHPQRFTDYRQVLGFQCFKRGIHYWEVELQQGSFCGIGVCYGSMERQGPE
SRLGRNSKSWCIEWLNSKISSWHNDVEKCLPNTKATKIGVLLHCEGGFVIFTAVGEKHNL
IYKFKAQFTEALYPAFWLFSSDAVLSLCHM
Download sequence
Identical sequences H0ZGW5
59729.ENSTGUP00000009828 ENSTGUP00000009828 ENSTGUP00000009828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]