SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009829 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009829
Domain Number 1 Region: 933-1171,1201-1302
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-89
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000455
Further Details:      
 
Domain Number 2 Region: 212-308
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000196
Family Ubiquitin-related 0.023
Further Details:      
 
Domain Number 3 Region: 673-716,843-848,876-902,974-1055,1471-1568,1639-1766
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000422
Family PBS lyase HEAT-like repeat 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009829   Gene: ENSTGUG00000009530   Transcript: ENSTGUT00000009935
Sequence length 1873
Comment pep:known chromosome:taeGut3.2.4:8:22988335:23017934:-1 gene:ENSTGUG00000009530 transcript:ENSTGUT00000009935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFEWFTKGQHDLESDVQQQLFKEKILKLESYEITMNGFSLFKTFFENVNLCDHRLKRQG
TQLSVEKLELIGMDFIWKIAMESPDEEIANEAIQLIINYSYINLTPRLKKDSVSLHKKFI
ADCYTRLEAASSALGGPTLTHAVTRATKMLTATAMPTVATSVQSPYRSTKLVIIERLLLL
AERYVITIEDLYSVPRTILPHGASFHGHLLTLNVTYESTKDTFTIEAHSNETVGSVRWKI
AKMLNSPVENIQIFANDSLLTVNKDQKLLHQLGFSDEQILTVKTSGSGTPSGSSADSSTS
SSNSSSVFSSSYAMEQEKSLPGVVMALVCNVFDMLYQLANLEEPRITLRVRKLLLLIPTD
PAIQEALDQLDSLGRKKTLLSESSSQSSKSPSLSSKHQHQPSASSILESLFRSFAPGMST
FRVLYNLEVLSSKLMPTADDEMARNCAKSFCENFLRAGGLSLVVNVMQRDSIPSEVDYET
RQGVYSICLQLARFLLVGQTMPTLLDEDFIKDGVEALSSRPFRNVSRQASRQMSICGTPE
KSSYRQLSVSDRSSIRVEEIIPAARVAIQTMEVNDFTSTVACFMRLSWAAAAGRLDLVGS
SQPIKESNTLFPAGIRNRLSSSGGNCSSGSEGEPTALHAGICVRQQSVSTKDALIAGEAL
SLLVTCLQLRSQQLGSFYNLPCVADFIIDILLGSPSAEIRRVACDQLYTLSQTDTSAHPD
VQKPNQFLLSVVLGAQLPLWSPTSIMRGINQRLLSQCTEYFDLRCQLLDDLTSSEMEQLK
ISPAAMLEDEITWLDNFEPNRTAECETSEADNILLAGHLRLIKTLLSLCGAEKEMVGSSL
IKPLLDDFLFRASRIILNSHSPAGSAAISQQDFHPKCSTADSRLAAYEVLVMLADSSPSN
LQLITKELLSMHHQCDPALTKEFDYLPPVDSRSISGFVGLKNGGATCYMNAVFQQLYMQP
GLPEALLSIDDDTDNPDDNVFYQVQSLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQ
QDAYEFFTSLIDQMDEYLKKIGRDQIFKNTFQGIFSDQKICKDCPHRYEREEAFMALNLG
VTSCQSLEISLDQFVRGEVLEGSNAYYCEKCKEKRTTVKRTCIKVLPSLLVIHLMRFGFD
WESGRSIKYDEQIRFPWMLNMEPYTVSGMARQDSSSEVGENGRNTDQGGGGGGSPRKKVA
PTENYELVGVIVHSGQAHAGHYYSFIKDRRGCGKGKWYKFNDTVVEEFDLTDETLEYECF
GGEYRPKVYDQSNPYPDVRRRYWNAYMLFYQRVSDQNSPVLPKKSRVSVVRQEAEDLSLS
APSSPEISPQSSPRPHRPNSDRLSILTKLVRKGEKKGLFVEKMPVRIYQMVRDENLKFMK
NRDVYSSDYFSFVLSLASLNATKVKHPYYPCMAKVSLQLAVQFLFQTYLRTKKKLRADTE
EWIATIDALLSKSIDACQWLVEYFVGPEGRELVKTFLLECSVREVRVAVATILEKTLDSA
LLYQEKLKTLHQLLEVLLALLDKDVPENCKNCAQYFLLFNNFVQKQGIRASSLLLRHSAL
RHMVNFLLGPNRQSNQNRRWSSAQAREFGYLHNTVALLVLHSDVSSQRNVAPGLFKQRPP
LSITTSGPLLVLHEEVEALLFLSEGKPYLMEVMHALRELTGSLSVLMEMVVYCCFCNEHF
SFTVLHFIKTQLETAPPHELKNIFQLLHEILVIEDPLQVERIKFAFETENGLIGNTLMHH
SNHVDSSRCYQCVKFLVTLAQKCPTAKDYFKENSHHWSWAVQWLQKKMSEHYWAPQSNVS
NETSTAKTFQRTISAQDTLAYATALLNEKDQSGSSNGSESSPANENGERHLQQGSESPMM
IGEPKSDLDDVDP
Download sequence
Identical sequences H0ZGW6
ENSTGUP00000009829 ENSTGUP00000009829 59729.ENSTGUP00000009829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]