SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009867 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009867
Domain Number 1 Region: 118-395
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-77
Family Protein kinases, catalytic subunit 0.000000000553
Further Details:      
 
Domain Number 2 Region: 384-441
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000374
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 3 Region: 917-953
Classification Level Classification E-value
Superfamily UBA-like 0.0000306
Family TS-N domain 0.071
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009867
Domain Number - Region: 7-69
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0123
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009867   Gene: ENSTGUG00000009557   Transcript: ENSTGUT00000009973
Sequence length 988
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:17020582:17030576:1 gene:ENSTGUG00000009557 transcript:ENSTGUT00000009973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAEEGTDWLLELLTELQLQQYFLRIRDELNVTRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRPESELPPQPQSTFRKPPTPPPPEAGGQHSLTCLVRE
RDLSIFEKLGDGSFGVVRRGEWCTPAGKTLNVAVKCLKTDVLSQPEALDDFIREVNAMHS
LDHRNLIRLYGVVLSHPMKMVTELAPLGSLLDRLRKNQGHFLISTLCQYAIQVAKGMAYL
ESKRFIHRDLAARNILLASNELVKIGDFGLMRALPKNDDHYVMQEHRKVPFAWCAPESLK
TRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNV
MLQCWAHKPEDRPTFVALRDFLVEAQPTDMRALQDFEEPDKLHIQMNDIITVIEGRAENY
WWRGQNKRTLKVGQFPRNTVTSVAGLSAHDISQPLKNSFIHTGHGDTNPQHCWGFPDKID
ELYLGNPMDPPDILGVDPSAARPTQLPGRAKRQPPPRPPQPTVLLTKPCYDPVSEEEEGL
PGGLRKLCLKKPGAGKGLRPVKPSARVPGTKGLASSEVTLIDFGEEVPQGSPSPSPTRAL
PRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDIEVCSITSPPSRRGKTNYGFVDESERGP
VLEDNLFLPPKETKQPSMMQTTELFEELQQECLRRLNVPLGPASPVDDKPQIPPRVPIPP
RPLRRNEPGRWSGDLSPASGGEEDRPPQIPPRDPLSQPTSRTPSPMALQQRAALCSCLST
SPGKPMPTTQSFALDPKYATPKVIQAQGKDCSKGPCILPIVKDGQKVSSTHYYLLPERPA
YLDKYEKFFKEAKSPEEVAASRQVTTATVRPMVQQPLSDCKANFSSNNSNPGPKCLVKAS
CSLQKIVYDGPDVCSPADKIRLVQDAVHGVTTEECQTALQNHGWNVQRAIQYLKVEQLFC
LGLKSRGECQRVLERFDWNLAQASSHLL
Download sequence
Identical sequences H0ZH03
ENSTGUP00000009867 59729.ENSTGUP00000009867 ENSTGUP00000009867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]