SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009885 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000009885
Domain Number - Region: 992-1032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00345
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 793-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00452
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009885   Gene: ENSTGUG00000009581   Transcript: ENSTGUT00000009992
Sequence length 1054
Comment pep:novel chromosome:taeGut3.2.4:9:17037175:17045373:1 gene:ENSTGUG00000009581 transcript:ENSTGUT00000009992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLYPFGMEGGDQEYVQRMVDFNSPLFKPEIGFPFGKSLQDALYFTDNGQIIFPPTDNHVP
SNPNPPPKGFTGQESLPMVAAFWDDADFSKGVGTTWYQEYSTLSSTQDPVVRDVEAKIEK
YLKIPYVAKWTLKVTWEKAPAYPSQRDDTQTSTYQAVLTTDGNCSFALLLYQDGGMRWDY
TRLAAANVLIGFSSGDGYAQNNELTQKPPAVKYRPDQQSSTGSGMAPGLASRSRLRSRVN
YRLWCLAWLDTEPAPATWNSQLPPCPCSRPQAELDPRYHWSRADTSMRMLRSASPSPAGA
GVRCLYQGGSLLEGWQERTWSLPFHTAPAFDWCCRRVGKPLFCAKFAEKRPRVGCEGYVP
PTPAGAFGDPHLTTLDGLTYTFNGLGDFVLLLASDAQTSFILHGRTAQTGMAQATNFVAF
AAQYISNTTTTVEWTLGSQDDIQVLLNNKIIQFSYSQDLGDGIYYSPGVLLVNTSSVTAV
FGGTISVSVLATSGILSVVCSLPNWYCNSTRGLLGVWDHDPTDDFQMPNGTSIPVNSSEE
EIYSYGMTWAVREHSLFTQPLGSPALNFTPFFLSRLRQENESQYELAALQCHGSKECIYD
SLSTGNLALGLATQSLAADFQQRKIALNPFPPVITGDASITAFRTEKGQKAITCGAGARF
IPHLSPELNISENGTLVWEPRGAAPFTVSLEAVGSNNISALLQLRFTLCRCSRSQDCDYS
NTVILRESSLQLAACRCESGYSGAFCQDPPDPCSQGCFPGVGCDPFSGCGPCPAGLTGDG
EHCSGCGSACGYHSCPEGYCSNGGHCHLHPITCAPTCTCPPAFTDQHCLVAGGDFQPLPT
SGLPRRSIQMRIKTLQNTTAEEVNSTVSAILGSLEVKAFQRNTNITQMHGGAQTDSDGFT
FVVVSEFAYESRGTIIRFLNEELPTAITNAFNARRGRRAAGTGLRFQRLHRDNITDLVKL
TVDELRDYFRCTLYGYKGYRLHYVGIIGFVCISPCKMGYCQHGGQCQHLPEGPMCSCLPF
SIYSPAGLQCQWLAISLAAFLGILLGALALLCLL
Download sequence
Identical sequences H0ZH21
ENSTGUP00000009885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]