SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009905 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009905
Domain Number 1 Region: 514-559
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 2 Region: 73-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 12-59
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000115
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009905
Domain Number - Region: 468-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009905   Gene: ENSTGUG00000009598   Transcript: ENSTGUT00000010012
Sequence length 559
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:23595643:23613073:1 gene:ENSTGUG00000009598 transcript:ENSTGUT00000010012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSSRDVNSPAPVDCQLSQWSGWTDCFPCQEKKHRHRRLARPAEFGGQRCAGHLWDEQACR
AETTCSGPPGCGQDFQCKETGRCIQRHLVCNGDRDCRDGSDEDNCEDEDIENPCEHLFPI
PGVEKIVQGYNILTQEGRQNVYDPGFFGGLCEYVYNGEWRELRYDAACERLHYGDDEKYF
RKPYNFHDYQFLAHADSGFAFEFYDDSKDLLDALKSDKSKTTGFTIGIGPGGADLTLNLG
LTLSGGKGSLKNFTQYDAKEVGFIRAVTKVQTARFKMRRDNVVLDEDVLLSLQDLPDTYN
YGMYAKFINDYGTHFMTSGTMGGVFEYILVINKEEMRRKAISIEEISACVGLSLGITASR
ESLALGAALTHSDCKQKGLLDTDAESHGAVVEDIIPRIRGGDTSYSGGLLKSWDGKMYRH
WGRSLKYNPAVIDFQLQPIHEILRRSNLGSVESKMQHLKRAVDEFLLEFSPCRCGPCHNN
GEPVLVGASCSCQCRPGYRGPACQHTERKGGETDGRWSCWSGWSPCQAGTTQRSRHCSNP
APRHGGQPCAGRDLQSRAC
Download sequence
Identical sequences H0ZH41
ENSTGUP00000009905 ENSTGUP00000009905 59729.ENSTGUP00000009905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]