SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009929 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009929
Domain Number 1 Region: 246-346
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.26e-28
Family Ras-binding domain, RBD 0.00000246
Further Details:      
 
Domain Number 2 Region: 1005-1101
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-22
Family PDZ domain 0.0000287
Further Details:      
 
Domain Number 3 Region: 38-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-22
Family Ras-binding domain, RBD 0.015
Further Details:      
 
Domain Number 4 Region: 405-501
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.36e-21
Family FHA domain 0.00000253
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009929
Domain Number - Region: 1370-1501
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00186
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009929   Gene: ENSTGUG00000009578   Transcript: ENSTGUT00000010036
Sequence length 1827
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:40484220:40598138:1 gene:ENSTGUG00000009578 transcript:ENSTGUT00000010036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGSREEERRKLADIINHWNANRLDLFEISDPTEDLEFHGVMRFYFQDKAAGNFATKCIR
VSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDVDEKPLVVQLNWNKDD
REGRFVLKNENDTLAPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRREKEALRQAS
DKDDRLLHGDDIENFRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSD
GRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVIEALEKYGLEKENPKDYCIARVM
LPPGSQHSDDKGAKETILDDDECPLQIFREWPSDKGILVFQLKRRPPDYVPKKTRKITDG
KPLKGKERVDGSGYGSCLPPEKLPYLVELSPGRRNHFAYYNYHTYEDGSDSRDKPKLYRL
QLSVTEVGTEKFDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSIDAETYVEGQRISETT
MLQSGMKVQFGSSHVFKFVDPTQDHIISKRSTDASLMVKGPRHKTGAVQETTFDLEGDIH
SGTALPASKSTSRLDGDRTSSASSTTERGMVKPMIRIDQQDYRRQDSRSQDTLGPELILP
ASIEFRESSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSSQYRPDITPAERTHK
VIAIVNKMVNMMEGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSRITVDA
QDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENNPQRPKIDDVLHTLTGAMSLLRR
CRVNAALTIQLFSQLFHFINMWLFNRLVTAPDSGLCSHYWGAIMRQQLGHIEAWAEKQGL
ELAADCHLSRIVQATTLLTMDKYSHADVPNINSTCFKLNSLQLQALLQNYHCAPDEPLIP
TELIENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNVPSGLQEF
LDPLCQRGFCRLTPHPRSPGTWTIYFEGADYESHLSHENAELAQPLRKEPEIITVTLKKQ
NGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAA
ELMTRTGSVVTLEVAKQGAIYHGLATLLNQPSPMMQRVSDRRGSGKPRPKSEGFELYNNS
TQNGSPESPQLPWTEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKNAYASGTTT
KITSVSTGNLCTEEQILPPRPEAYPIPTQTYTREYFTFPASKSQDRMGPAQSQWPNYEEK
PQLQAESNHSINTTMQRVARSQEELRDKVFQPERNRLEVYIDRKSDSDQWMNSSVDSSTS
SQEHLNHSSKPVSPGSCLTKSGPGRWKTPATSQPTPVAISQPIRTDLPPPPPPPPVHYAA
EFDELQMDLPLPPPPPPNQIGAQASSQVAAAERKKREEHQRWYEKEKARLEEERERKRRE
QERKLGQMRSQPLIPAQPVVPPVSLQQVKSEKPSTLQRSQETVIRELQPQQQPRTIERRD
LQYITISKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQNKPDRTAEEN
DRLRKLMLEWQFQKRLQESKQKDEDDDEEEDDEVDTMLIMQRLEAERRARLQDEERRRQQ
QLEEMRKREAEDRARQEEERRQQEEERTRREAEEKRRQEEEYYSRLEAERRRQHDEAERR
LLEPDEPGLYRPPLPREYELPSPTPSSNAPPPPPQRNTSYLKTQVLSPDTIYTAKFVAYN
DDDDDEEEDSNLAGINSYTGSTGAAAGEVYRDPRDKRSKSQDADLPGAPENLTFRERQRL
FSQGQDVSNKVKASRKLMELENELNTK
Download sequence
Identical sequences H0ZH64
ENSTGUP00000009929 ENSTGUP00000009929 59729.ENSTGUP00000009929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]