SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009932 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009932
Domain Number 1 Region: 496-542
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.00066
Further Details:      
 
Domain Number 2 Region: 75-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 19-67
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009932
Domain Number - Region: 176-202
Classification Level Classification E-value
Superfamily MxiH-like 0.0405
Family MxiH-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009932   Gene: ENSTGUG00000009617   Transcript: ENSTGUT00000010039
Sequence length 542
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:23619430:23644926:-1 gene:ENSTGUG00000009617 transcript:ENSTGUT00000010039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVARGRHARSVSVPPQPRDCILSSWSSWSKCDPCQKKRYRFARLEQPSQFSGDPCDGSDR
EAEQCVTNTPCRSRARCDGFVCAVTGRCIARRLLCNGDDDCGDQSDEKNCKKVFRKCDQK
MEEYWGVENLAKGLNIFTNSLEGLVLDHRYYAGGCSPHYITDTRFRKPYNVESYTPETKG
KYEFTMTEYDSYSNYESSVLKAKASQTSFSVGIKIPKVFELGYNSNDMRFKKFMQRMKRF
SSSSSKFIHARAELAVGVYKLKPRDLMLHHEFLRRLRQLPADYSYGEYRELFRDFGTHFI
KEATVGGIYEYTLVMNSEELRKAGFSLSDVQKCAQKGFNVDVNFGKFSVGLGVDSAGCRA
LLKEIGDSTARKQFVEDFLALVRGGASEDITTLAHKDLPTAQLMQQWGDAVQYNPEIIKL
KAEPLYELVTPSDLADSMKIKENLRRALDEFQLESSSCRCAPCHGNGTPFLRVHCYCLFL
KVLSSFVVVSFPDAAVNGNWGCWASWSPCSGGQRTRRRQCNNPAPQNGGSSCPGPASEAA
PC
Download sequence
Identical sequences H0ZH67
ENSTGUP00000009932 ENSTGUP00000009932 59729.ENSTGUP00000009932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]