SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009935 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009935
Domain Number 1 Region: 129-219
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.71e-20
Family Ubiquitin-related 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009935   Gene: ENSTGUG00000009637   Transcript: ENSTGUT00000010042
Sequence length 227
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:21501945:21506599:-1 gene:ENSTGUG00000009637 transcript:ENSTGUT00000010042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCAGRQRRERPAAGGNTRKRAGRNEPLKKECPKWKSDYPMTDGQLRSKRDEFWDTAPA
FEGRKEIWDALKAAAYAVEANDHSLAQAILDGASITLPHGSLTECYDELGNRYQLPVYCL
APPVNLILERSEEEAVEPAEPPPNARREFTLKVRLSTGKDLRLSASMSDTIGQLKKQLQA
QEGIDLAWQRWFFSGKLLTDRTRLQETKIQKDFVVQVIVNQPLPPRN
Download sequence
Identical sequences H0ZH70
59729.ENSTGUP00000009935 ENSTGUP00000009935 ENSTGUP00000009935 XP_002194670.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]