SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009949 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009949
Domain Number 1 Region: 218-361
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-28
Family Third domain of FERM 0.0049
Further Details:      
 
Domain Number 2 Region: 109-215
Classification Level Classification E-value
Superfamily Second domain of FERM 8.11e-27
Family Second domain of FERM 0.0014
Further Details:      
 
Domain Number 3 Region: 15-109
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-18
Family First domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009949   Gene: ENSTGUG00000009646   Transcript: ENSTGUT00000010056
Sequence length 532
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:40665157:40692995:-1 gene:ENSTGUG00000009646 transcript:ENSTGUT00000010056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRTLLAGRMQPEIRSVCVFLPTREQLSLAVGVKATGQELFQQVCDLVKIKEPHFFGLSI
VKNNEYVFIDLEQKLSKYFSKEWKKETTKGTEKFSPPFVAFFRVQYYVENGRVIGDKVAR
QLYYCHLKEQVLMSHCNHKEEIYFLLAAYSLQADLGNYREKIHAGKYFEPQAYFPQWIIA
KRGSDYILKHAPEMHREQQGLSAKEAVLKFIKESCLLEDVPVHFYRLQKDKKEDRPTVIL
GLTLRGMHIYQEVNHVRQLLYDFPWSHIGKLAFLGKKFEIQPDGLPSARKLVYYTGCPFR
SRHLLQLLSNSHRLFLNIQPVLKQIQKLEEAEEKKRYRESYISDTLDMDLDPCDKNSRGS
GSSGGSRRDNRLSRQSTGSHGSSHTSGIEADSRHRVSVEMSVDEPFSIDRVHRKEKSCSS
TISYGSSGIDSGSKGRAEDDAQDDELELAVDEPEEMPVDEPLEGDQLEEATVGESVESLP
LDAASCQAINQESLSVVQVTLIKMRGQSVESLQQVRSPKSRSCMDQHSQSLD
Download sequence
Identical sequences H0ZH84
ENSTGUP00000009949 ENSTGUP00000009949 59729.ENSTGUP00000009949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]