SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009978 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000009978
Domain Number - Region: 72-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0573
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009978   Gene: ENSTGUG00000009681   Transcript: ENSTGUT00000010085
Sequence length 110
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:16357231:16359854:-1 gene:ENSTGUG00000009681 transcript:ENSTGUT00000010085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLHPLPLELSGQHQVKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPS
CVEASIVLQKWWCHMNPCLDGEDCKVLPDYSGWSCSSGNKVKTTKASTEI
Download sequence
Identical sequences H0ZHB3
59729.ENSTGUP00000009978 ENSTGUP00000009978 ENSTGUP00000009978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]