SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010001 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010001
Domain Number 1 Region: 299-419
Classification Level Classification E-value
Superfamily EF-hand 2.45e-32
Family Osteonectin 0.0086
Further Details:      
 
Domain Number 2 Region: 207-279
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.22e-21
Family Thyroglobulin type-1 domain 0.0012
Further Details:      
 
Domain Number 3 Region: 72-153
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.96e-20
Family Thyroglobulin type-1 domain 0.0012
Further Details:      
 
Domain Number 4 Region: 37-83
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000416
Family Ovomucoid domain III-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010001   Gene: ENSTGUG00000009682   Transcript: ENSTGUT00000010108
Sequence length 426
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:40960154:41093121:1 gene:ENSTGUG00000009682 transcript:ENSTGUT00000010108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVPLLLLLPELLPAVPAQKLSALTFLRVDQDKDRECSLDCAGSPQKSLCASDGRTFLSR
CEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQ
CHSYTGYCWCVTPNGRPISGTAVAHKTPRCPGSVSEKLPQREGAGKADDASAPALETQPQ
GDEEDIASRYPTLWTEQVKSRQNKTNKSSASSCDQELQSALEEAKQPQKDNVFIPECAQG
GLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNGARAHPTKTKDLYKGRQLQG
CPGAKKNEFLTSVLDALSTDMVHAVSDPSLSSSRVSEPDPNHTLEERVVHWYFKQLDKNS
SGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSLSVQELMGCLGVTKEEGKAE
TKKRHS
Download sequence
Identical sequences H0ZHD6
ENSTGUP00000010001 59729.ENSTGUP00000010001 ENSTGUP00000010001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]