SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010031 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010031
Domain Number 1 Region: 962-1175
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-104
Family Thrombospondin C-terminal domain 0.00000000536
Further Details:      
 
Domain Number 2 Region: 31-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-38
Family Laminin G-like module 0.0000125
Further Details:      
 
Domain Number 3 Region: 839-961
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.45e-37
Family TSP type-3 repeat 0.000000571
Further Details:      
 
Domain Number 4 Region: 770-841
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.27e-17
Family TSP type-3 repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 498-549
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.44e-16
Family TSP-1 type 1 repeat 0.0001
Further Details:      
 
Domain Number 6 Region: 442-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000575
Family TSP-1 type 1 repeat 0.0001
Further Details:      
 
Domain Number 7 Region: 697-782
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000157
Family TSP type-3 repeat 0.0001
Further Details:      
 
Domain Number 8 Region: 323-380
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000136
Family VWC domain 0.0025
Further Details:      
 
Domain Number 9 Region: 387-430
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000111
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 10 Region: 554-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000116
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010031   Gene: ENSTGUG00000009705   Transcript: ENSTGUT00000010138
Sequence length 1175
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:41356645:41384975:-1 gene:ENSTGUG00000009705 transcript:ENSTGUT00000010138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRRGLLWLTVLITLWVSSNAQDGDKEEETTFDLLQVSNINRKTVGAKVFRGPDPTMPA
YRFIRFDHIPPCKPEKLKKILKLIRQNEGFILSATLRQDRQSRGTILALEGPGISERQFE
IISNGRANTLDLIYWVDGFQNVISLEDVDLADSQWKNLTVQITGENYNLYVGCDLIDSFI
LEEPFYEQLKAESSRLYVAKGSTRENHFRGLLQNIQLIFDTSIEDVLRKKGCQRSQSTEV
NTINESTEILHLSPAVTTEYVGEKPEKAEFCDRSCEELGSMFTELTGLRIVVNNLADNLQ
KVSEENQIMWELIGPNKTMKNQPVCWQDGRVFADNESWIVDSCTKCICQDSKIVCNQITC
PAVSCADPVFVEGECCPVCSHSDDSEEGWSPWSDWTKCSVTCGSGTQMRGRSCDVTRSAC
TGPHIQTRMCSFKKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPIPQMGGKN
CVGNGRETEKCEKVPCPVNGQWGPWSPWSACTVTCGGGIRERSRLCNSPEPQYGGKPCVG
DTKQHDMCNKKDCPIDGCLSNPCFPGAECNSYPDGSWSCGACPAGYLGNGTFCEDLDECI
AVSDVCFKVNQVHRCVNTNPGFHCLPCPPRYKGSQPYGVGLEVAKTEKQVCEPENPCKDK
THSCHKSAECIYLGHFSDPMYKCECRTGYAGDGRICGEDSDLDGWPNNNLVCAANATYHC
VKDNCPLLPNSGQEDFDKDGKGDACDEDDDNDGVEDDKDNCPLLFNPRQFDYDKDEVGDR
CDNCPYVHNPAQIDTDNNGEGDSCAVDIDGDDIFNERDNCPYVYNTDQSDTDGDGVGDQC
DNCPLMHNPDQTDADNDLVGDQCDNNEDIDEDGHQNNQDNCPYIPNANQADHDQDGKGDA
CDPDDDNDGVPDDRDNCRLRYNPEQEDSDGDGRGDICKDDFDNDNVPDIYDVCPENNAIS
ETDFRKFQMVPLDPKGTAQIDPNWVIRHQGKELVQTANSDPGIAVGYDEFSSVDFSGTFY
VNTDRDDDYAGFVFGYQSSSRFYVLMWKQVTQTYWEDKPTRAYGYSGVSLKVVNSTTGTG
EHLRNALWHTGNTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGLIKVLVYEGKQVMV
DSGPIYDTTFAGGRLGLFVFSQEMVYFSDLKYECR
Download sequence
Identical sequences H0ZHG6
59729.ENSTGUP00000010031 ENSTGUP00000010031 ENSTGUP00000010031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]