SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010058 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010058
Domain Number 1 Region: 265-364
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.36e-32
Family Ras-binding domain, RBD 0.0041
Further Details:      
 
Domain Number 2 Region: 400-512
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-17
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010058   Gene: ENSTGUG00000009747   Transcript: ENSTGUT00000010165
Sequence length 600
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:19859618:19899435:-1 gene:ENSTGUG00000009747 transcript:ENSTGUT00000010165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLSDEELDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDADKPVAPVKRSPLRQET
NLANFSYRFSMYNLNEALNQGETVDLDALMADLCSIEQELSSIGSHSANNAAVKRLATEP
KTQKLPASRPPVKHSSVKGLSSSAKVTKASHANVSLDDITAQLEKASLSMDEAAQQSVAE
DTKPVVTAQHRRTASAGTVSDAEVRSISNSSRSSVTSAASSMDSLDIDKVTRPQELDLAS
LGQPVTEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVL
DNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLMFVERIEKY
ALFKNPQNYLLGKKETSEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKEDGKKSWKKRY
FLLRASGIYYVPKGKAKVSRDLVCFLQLDHVSVYYGQDYRNKYKAPTDYCLVLKHPQIQK
KSQYIKYLCCDDVRTLHQWINGIRIAKYGKQLYMNYQEALKRTESAYDWTSLSSSSIKSG
SSSSSLPESQSNHSNQSDSGVSDTQTAGHVRSQSIVSSMFSEAWKRGTQLEESSKVTRRL
Download sequence
Identical sequences H0ZHJ3
ENSTGUP00000010058 ENSTGUP00000010058 59729.ENSTGUP00000010058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]