SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010081 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010081
Domain Number 1 Region: 7-50,88-120
Classification Level Classification E-value
Superfamily Chromo domain-like 4.12e-22
Family Chromo barrel domain 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010081   Gene: ENSTGUG00000009742   Transcript: ENSTGUT00000010188
Sequence length 359
Comment pep:novel chromosome:taeGut3.2.4:10:20166823:20182618:-1 gene:ENSTGUG00000009742 transcript:ENSTGUT00000010188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKQDPPNFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNTAVSLLGSS
GIDQHDLIPELLIHFGLELCHADLFVSGWDEWVPESRVLKYVDTNLQKQKELQKANQEQY
AEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGIGEGSSTSETPQPPRKKRARVDPTV
ESEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSR
GNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLL
RLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSSALFSASDYEVAPPEYHRKAV
Download sequence
Identical sequences H0ZHL6
ENSTGUP00000010081 ENSTGUP00000010081 59729.ENSTGUP00000010081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]