SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010146 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010146
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.81e-44
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010146   Gene: ENSTGUG00000009838   Transcript: ENSTGUT00000010253
Sequence length 209
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:15857782:15859240:1 gene:ENSTGUG00000009838 transcript:ENSTGUT00000010253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILDVTIYYRGKEFHHEVVGGSHCLLTYQCPSLPGAPSPGHVVRFPSPASLADGKQRRFTE
DLLGIARLWLEQRAYKVFATRQAKCKVFWALSQQLEGVEDPPLNLLCRDQETPIFDFHEF
CTELRDFRNGQRRRSPDFTIYLCFGQAFSKAKPKESKLILVKLVPKFCEYYYEQVLQEGA
SSLDSRTISLQLSNSFDLMELIEQYSMQL
Download sequence
Identical sequences H0ZHT0
ENSTGUP00000010146 ENSTGUP00000010146 59729.ENSTGUP00000010146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]