SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010147 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010147
Domain Number 1 Region: 99-214
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-25
Family Cadherin 0.00018
Further Details:      
 
Domain Number 2 Region: 212-328
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-19
Family Cadherin 0.00089
Further Details:      
 
Domain Number 3 Region: 434-539
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-17
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 322-442
Classification Level Classification E-value
Superfamily Cadherin-like 5e-17
Family Cadherin 0.0043
Further Details:      
 
Domain Number 5 Region: 37-111
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000243
Family Cadherin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010147   Gene: ENSTGUG00000009813   Transcript: ENSTGUT00000010254
Sequence length 739
Comment pep:known_by_projection chromosome:taeGut3.2.4:11:20167786:20179526:-1 gene:ENSTGUG00000009813 transcript:ENSTGUT00000010254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHKRQKRDWIWNQMHIKEEIDTPLPHHVGKITSSVRNNNAKYIIEGEYANTIFKVEETSG
DVYAFERLDREKKAEYELTALIIDRTNNRSLERPSKFIIKVYDINDNAPVFVQKVFNGSV
PEMSPVGTSVTKVTAVDADDPTVSGHATVTYEVTTGGEYFTIDDSGVIYTKEPNLDRETK
STYEIVVQAKDAPGFSGDSSTATVIITLSDINDNFPVFKHSSFHFKVPENISVGGEVGRV
KVEDIDEPQHRNTRYSFIQGEFRDTFDIVANPYTNEGIFRPKKPLDFETVSEYRFSIEAT
DPTVNLRHFKPGNPRSIATVTIEVTDVDEPPVFTKPSYEFKVRENHAEVKTLGSVHAEDP
DAAKRKIRYIQRRANPNGDYIRVSNNGVIQLPKPLDREFSSSYNITVAAVEILEDGRLSD
RESHAHVHVIVDDVNDNAPELVSPEEPRVCENAAPGKVIVRISAVDKDETSPRGFFRYSL
ATEDSNFSLIENYDNTANITVKYGQFNRELAKFHYLPVLISDNGDPDLTSTNTLVISVCK
CNEKGNFTFCEERAKQVGVSIQALVAIFICIFTIIVIALLILLRKRHKKDLSGLGRSVAE
IHEQLVTYDEEGGGEMDTTSYDVSVLNSVRKNGLKAEAAPSPYAQVQKPPGNVPPGAGGM
EMMIEVKKDEADNDRDLLPYDTLHIYGYEGAESIAESLSSLGSGSSDSDIDYDFLNDWGP
RFKMLAELYGSEPSEDFVY
Download sequence
Identical sequences H0ZHT1
ENSTGUP00000010147 ENSTGUP00000010147 59729.ENSTGUP00000010147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]