SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010168 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010168
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-28
Family Ras-binding domain, RBD 0.0000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010168   Gene: ENSTGUG00000009857   Transcript: ENSTGUT00000010275
Sequence length 439
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:15910285:15914504:-1 gene:ENSTGUG00000009857 transcript:ENSTGUT00000010275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKVWVDGIQRVVCGVSEHTTCQEVVIALARAIGQTGRYVLVQKLREKERQLLPLECPL
ESLAKCGQYASDVQFILRRTGPSMAERPSSEGAPQAPERTFIRASLPIKPRLTSIDGPRS
REPKKSMTFSLGPTGSSDLFTMGRWRHQTRDGLDLEGGGVVQPSKEELFRRVLQQQEQLH
SLEAHGDTLEMDLRLWERSRIAGQENEILYLEQLVRRNETELGEEEFWQSELQLEKECER
ERQERVRSLRASLEEYTQRIYELSVRTEALQEEIQWEMAERAKRGKEISMPSPIELEDMA
TKMKRDLEAKVKQGTQLESNLASVEKALEEAEKNLQAQTQELEELNKELRQCNLQQFIQQ
TGATVTVLQARSEEDAQPEPSPCELPAYRRNGGFSPTAGTDLPPQVSTKQLLGHPRTLPE
PLVSSLNPEAVPTRQSIWR
Download sequence
Identical sequences H0ZHV2
59729.ENSTGUP00000010168 ENSTGUP00000010168 XP_012429517.1.42559 ENSTGUP00000010168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]