SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010187 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000010187
Domain Number - Region: 15-146,211-339
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000981
Family YVTN repeat 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010187   Gene: ENSTGUG00000009875   Transcript: ENSTGUT00000010295
Sequence length 688
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:21807911:21810043:-1 gene:ENSTGUG00000009875 transcript:ENSTGUT00000010295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRQVSDLSDFSRGHWLRELLCRGEEPSHVQSSPDGQHLLLLQKSRPPTLPRVVAFQRHSI
AGADLERSWQPPQPALVGLLFLQSPVVPDSWVLAVVWEHGRTEVWHFVVAVGWQLLQTLE
LCQGARARVVSVCSQGASLVWCEERPPLGAHSDMSKCAFRFCVCARALEVGEQGVRLGTA
RIVLHNSPEYRVLASPQHVFLVPAAASFATTSKFLLIWHPEKAEFTITAPSAGFIHSKVL
HSSSESDFKKLLLGSVGLLSGFAPLDIHTSTVSNSGGLLLVSTKGSVSVVEPDGTQRHIF
DLEGGPLAQGSPVQLKTFGSILACVLAGVLYLVDQNSGRLVEKEVLSMKEVHFLESQGEE
DSIQLLSQSGIYSFSFSKPEDSSRPEPCLVEMVFEEACRYYQRRSLSSSKLTVEKLKKGG
TFQAPQKPARSLQDTYAKLLSTVSLELQSYMSLELLKTCVVCASESEVESYCKELVEQEV
SRILQSDMDKDNLAYLNSVFASFPKAAWKATRSCLQLQQNGDGLLVARATPEVWKKVLCQ
PQLEEVGQNGIVPLFELICASFLRFKPKWLPSFVELTQQYQGGPRGPGPLYKRALGVLAR
KSKHGEADDEMELELLLCSKRPKAVLQALHLLIHLKQWQRVVEVAEKFSKLSPLLNKEIF
VTLLAEFAQHRELDPYLDRLWPLCPAEL
Download sequence
Identical sequences H0ZHX1
ENSTGUP00000010187 59729.ENSTGUP00000010187 ENSTGUP00000010187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]