SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010199 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010199
Domain Number 1 Region: 392-587
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-46
Family SPRY domain 0.0093
Further Details:      
 
Domain Number 2 Region: 325-422
Classification Level Classification E-value
Superfamily Fibronectin type III 9.36e-19
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 112-171
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000397
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000010199
Domain Number - Region: 41-76
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00272
Family TFIIH p44 subunit cysteine-rich domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010199   Gene: ENSTGUG00000009874   Transcript: ENSTGUT00000010307
Sequence length 588
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:42085064:42118163:-1 gene:ENSTGUG00000009874 transcript:ENSTGUT00000010307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCPQCHRASLDQRGLRGFQRNRLLEAIVQRYQQGRAAAAAAAKCQLCDRSPPEPAAVLCE
QCEVLYCAACQLRCHPARGPFAKHRLAPPPAHPGAPGGGGDGGGGKGAGGGRKLPTCAEH
DLENYSMYCVSCRSPVCYQCLEEGKHSKHDVKALGAMWKQHKAQLSQALNGVSDKAKEAK
EFLVQLKNLLQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKVVWDQ
INHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPKVSAE
FDLTLDSEPLLQSIHQLDFIQMKFPVSVPPVPLLQLEKCCTRNNSVTLAWRMPPLSHNPV
EGYILELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVILQT
SDVAWFTFDPSSAHRDIVLSNDNQTATCNSYDDRVVLGTAAFSKGVHYWELHVDRYDNHP
DPAFGIARINVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVSKGATVGVLLD
LNKHNLTFYINGQQQGPPAFENIEGVFMPALSLNRNVQVTLHTGLEVP
Download sequence
Identical sequences H0ZHY2
ENSTGUP00000010199 ENSTGUP00000010199 59729.ENSTGUP00000010199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]