SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010251 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010251
Domain Number 1 Region: 169-309
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-32
Family Third domain of FERM 0.0028
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-21
Family First domain of FERM 0.00096
Further Details:      
 
Domain Number 3 Region: 60-171
Classification Level Classification E-value
Superfamily Second domain of FERM 7.59e-16
Family Second domain of FERM 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010251   Gene: ENSTGUG00000009926   Transcript: ENSTGUT00000010360
Sequence length 535
Comment pep:known_by_projection chromosome:taeGut3.2.4:10:20385965:20400541:1 gene:ENSTGUG00000009926 transcript:ENSTGUT00000010360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQMRAQPPFTMCFR
VKFYPTDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAGHCTCHSQGT
HWAGLGHGGLFVCLFWECLTITKRYKSNPCGQAPATSELNFLRKAQTLETYGVDPHPCKD
VSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKMKFEGKTFYLYVSQKEEKKIVLTYFA
PTPEACKHLWKCGIENQAFYKYVEKSSQMRTVSSSNLFFKGSRFRYSGRVAKEMESSAKI
KREPPEIHRAGLVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRS
ASHGDALAGPGRSGRAESSERVAVIADESYSPADSVLPTPVAEHSLELMLLSRQANGAPC
SIEEEKESEAGTPAAEAEGELRALCPGGTGLGPAQAQQVNKFLLSVLRLLLVTVGLLFVL
LLLLIVLTESDLDTAFFRDIRQTPEFEQFHYQYFCPLRRWFACKLRAVLSLLIDT
Download sequence
Identical sequences H0ZI34
59729.ENSTGUP00000010251 ENSTGUP00000010251 ENSTGUP00000010251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]