SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010326 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010326
Domain Number 1 Region: 299-441
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-39
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 195-300
Classification Level Classification E-value
Superfamily Second domain of FERM 6.93e-37
Family Second domain of FERM 0.00000272
Further Details:      
 
Domain Number 3 Region: 114-194
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-27
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010326   Gene: ENSTGUG00000009980   Transcript: ENSTGUT00000010435
Sequence length 1100
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:105674881:105738839:1 gene:ENSTGUG00000009980 transcript:ENSTGUT00000010435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKDKEQDQEESPAQEGTAESQPQEQQPQQPSEEHQTALEQFSAVAAHSTP
VRKEQATEKEQEFAAASAKQLEYQQLEDDKLSQKSSSSKLSKSPLKIVKKPKNMQCKVTL
LDGSEYACEVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDTENQKNWLDPAKEIKKQIR
SGAWQFAFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSE
LGDYDPDEYGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMY
GVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEF
EQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQT
RRASALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKTEE
DKDDEEGKKKRAEEVTPISAIRHDTKPSLLGTDSHHSSPSFQPGPHVSSAKLRRRCKEST
RTKSLGCEAPKESAPKHSELEPDSDRKGRVCSAEQDMAFGYKQKAGKGGTLFSFSLQLPE
SFPSLLDDDGYLSLPNLSETNLLPASVQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYAL
TLSFPLAMCLCYLEPKAASLSASLANDLSDSSEEETDSEQTDTAADGETTATESDQEEDG
DLKAQDLDKTQEDLMKHQTNISELKRTFLETSTETTVSNEWEKRLSTSPVRLAARQEDAP
MIEPLVPEETKQSTSEKLDGSDIFTLIESARKPTEFIGGVTSTSHTWAQRIETTTSQEIT
SSDMKQAAQPDQDTVQKVVQETVVVKERHGMEVHAGGDPAKVAGLTLDAQAEAASAVAAG
VKEKEGSAGTEGAKEEKREEAGKALTKQEGVATPASCEQAEEHRTTVQLSESLERKPHFE
SPVVKTETISFSSVPTGGETLEISTKEVPVVHTETKTITYESSQVDCGADSEPGVLMSAQ
TITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDM
SVTKVVVHKETEITPEDGED
Download sequence
Identical sequences H0ZIA9
ENSTGUP00000010326 59729.ENSTGUP00000010326 ENSTGUP00000010326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]