SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010351 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010351
Domain Number 1 Region: 162-261
Classification Level Classification E-value
Superfamily Immunoglobulin 9.98e-21
Family I set domains 0.0089
Further Details:      
 
Domain Number 2 Region: 44-130
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000628
Family Growth factor receptor domain 0.0037
Further Details:      
 
Domain Number 3 Region: 115-160
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000208
Family Ovomucoid domain III-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010351   Gene: ENSTGUG00000010037   Transcript: ENSTGUT00000010461
Sequence length 292
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:22486657:22489713:-1 gene:ENSTGUG00000010037 transcript:ENSTGUT00000010461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSISCLMLSLLSLHWALLQLGQAFPSTSDYLQRGWQRLLEEGEGCTECQPEECPMPRGCL
AGTVRDACDCCWECANLEGQICDLDNTNHFYGKCGEHLECRLDAGDMRHGEVPEPQCACL
SHLALCGSDGKTYAQICRFLEAAHAHPDANLTVAHEGPCEAEPQITSPPYDTWNVTGQDV
IFGCEVFAYPMASIEWRKDGTEMLLPGDDPHISVQFRGGPQKYEVTGWLQIQGVRVTDEG
TYRCFARNRVGEAVALASLTVFTPDQLNLTDFSVLKPHVTPEDYRESEEDYY
Download sequence
Identical sequences H0ZID4
ENSTGUP00000010351 ENSTGUP00000010351 59729.ENSTGUP00000010351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]