SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010369 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010369
Domain Number 1 Region: 194-293
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.5e-37
Family ets domain 0.0000894
Further Details:      
 
Domain Number 2 Region: 9-116
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.98e-25
Family Pointed domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010369   Gene: ENSTGUG00000010040   Transcript: ENSTGUT00000010479
Sequence length 298
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:16833226:16846131:1 gene:ENSTGUG00000010040 transcript:ENSTGUT00000010479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILEGAGRMSINSSSNLLHQQPSWTDGYSTCNVSSSFYGTQWHEIHPQYWTKFQVWEWLQ
HLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTQAAGTAGQLLYSNLQHLKWNGQCGSD
MYQSHNVIVKTEQTDPSLMVSWKEENYLYDSGYGSTVELLDSKTFCRAQISMMTPSHQSS
DSSDAKKSQDHTPKSHTKKHNPRGTHLWEFIRDILLNPEKNPGLIKWEDRSEGVFRFLKS
EAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
Download sequence
Identical sequences A0A091FQE6 H0ZIF2 U3KDJ6
ENSTGUP00000010369 ENSTGUP00000010369 XP_002199622.1.42559 XP_005419547.1.5688 XP_008637601.1.15636 XP_009100411.1.15306 XP_014121256.1.73095 XP_014729038.1.99236 XP_016153972.1.66865 ENSFALP00000013100 59729.ENSTGUP00000010369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]