SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010390 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010390
Domain Number 1 Region: 5-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000215
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010390   Gene: ENSTGUG00000010071   Transcript: ENSTGUT00000010500
Sequence length 132
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:22514544:22515460:1 gene:ENSTGUG00000010071 transcript:ENSTGUT00000010500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYVRQLQRLQLLFSPTAADARSARQFVEEAAQDFARQHPDVVLYVSPHSGPGPAPVLRAE
YLNGTVRDELIASKTSEEILQLATKMANQSGLDIIRIRKPFHTDNPSVQGQWHPLTNKPS
ILTVQGPRLQPK
Download sequence
Identical sequences H0ZIH3
59729.ENSTGUP00000010390 ENSTGUP00000010390 ENSTGUP00000010390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]