SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010431 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010431
Domain Number 1 Region: 15-51
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 96-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 56-93
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010431   Gene: ENSTGUG00000010116   Transcript: ENSTGUT00000010541
Sequence length 338
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:17396254:17463060:1 gene:ENSTGUG00000010116 transcript:ENSTGUT00000010541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADSQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDDSDEKECPKAKSKCGAT
FFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARFHCKNGLCIDKSFVCDS
QNNCQDNSDEESCESPQEAGSGQDYVTSENQLLYYPSITYAIIGSSVIFVLVVAFLALVL
HHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCSVTYNVNNGIQYMASQPYHRPVELD
SPPSYSEAVLDQSRPPWFDLPPPPYCSESESPNQPDLPPYRSRSGSLASTDTPVAESPVG
TSDSWTRDVHGSMDGHRTLLARTVDQSDPLVSHTAERE
Download sequence
Identical sequences H0ZIL4
ENSTGUP00000010431 ENSTGUP00000010431 59729.ENSTGUP00000010431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]