SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010437 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010437
Domain Number 1 Region: 351-474
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.43e-35
Family DEP domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 174-268
Classification Level Classification E-value
Superfamily PDZ domain-like 2.26e-21
Family PDZ domain 0.0000457
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000010437
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00155
Family DIX domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010437   Gene: ENSTGUG00000010112   Transcript: ENSTGUT00000010547
Sequence length 656
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:18080196:18094106:1 gene:ENSTGUG00000010112 transcript:ENSTGUT00000010547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVKEEISDDNAKLPCFNGRVVSWLVSAEGSHSDAGSVCADNQTELPPSMERTGGIGDSRP
PSFHPNTGGSRENLDNETETDSVVSSQRERPRRTDGPEHAPRVNGTVKGERRRDLGGYES
SSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKAPRIERSSSF
SSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEP
GDMLLQVNDINFENMSNDDAVRVLREIVHKPGPLSCTLAKCWDPSPRGCFSLPRSEPIRP
IDPAAWVSHTAAMTGTYPAYGMSPSMSTITSTSSSITSSIPETERLDDFHLSIHSDMATI
VKAMASPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHHVEGFTDRRESRKYASNLLKAG
YIRHTVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMA
FPYQYPPPHPYNPHPGFPDPSYSYGGGSAGSQHSEGDRSSGSNRSGSERRKEREKTGESK
SGGSGSESDHTTRSSMRRERAASERSVPASQHSQRSQHSLAHSIRSHHSQQSYGPPGLPP
LFSPPMLLMPPPPSAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
Download sequence
Identical sequences H0ZIM0
ENSTGUP00000010437 ENSTGUP00000010437 59729.ENSTGUP00000010437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]